KEGG   Emiliania huxleyi: EMIHUDRAFT_458126Help
Entry
EMIHUDRAFT_458126 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ehx03021]
    EMIHUDRAFT_458126
Transcription machinery [BR:ehx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     EMIHUDRAFT_458126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMCO5
Motif
Other DBs
NCBI-GeneID: 17268119
NCBI-ProteinID: XP_005775003
JGI: Emihu1_458126
UniProt: R1ENY8
Position
Unknown
AA seq 314 aa AA seqDB search
MYLFETFGGWCNAVKRLFYQMKDKVRNKLSKRQHEDEASWSTRSWLSLEAQRMSVALQLA
AAEEIATELRLTAASEDAAKRSLHAAIFGDDSDSDGDDNLPSLAHPESEKAMLTKLKPRR
GKIVRSREALTQEVVELQQQMEAAAERDDDAVALLPEVVTMLNKRHMQEVLIDQGMLTTL
AMWLKPMPDGSLVSLQVRTDLLRVLGLLEVDETVLGSLRSSSLGKYARLYSLSTRRSDRL
GPFSEPSRNLLLGTSASTRSTRRRPQRTGTRRRRSLRSGRGQSSALPPPSRPRTCRSGAA
RPRRISRGRRWRAW
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtacctgttcgaaaccttcggcgggtggtgcaacgcggtcaagcggctgttctaccag
atgaaggacaaggtgcgcaacaagctctcgaagcggcagcacgaggacgaggcgagctgg
tcgacgcggtcgtggctgtcgctggaggcccagcgcatgtcagtcgcgctgcagctcgcg
gcggcggaagagattgcgaccgagctcaggctcaccgcggcgtcggaggacgccgccaag
cggtcgctccacgccgccatctttggcgacgactccgactcggacggcgacgacaacctg
ccgtcgctcgcgcaccccgaaagcgagaaggcgatgctgacaaagctcaagccgcggcgc
ggcaagatcgtgcggtcgcgagaggcgctgacgcaggaggtggtcgagctgcagcagcag
atggaggcggccgccgagcgcgacgacgacgccgtcgccctgctgcccgaggtcgtcacg
atgctcaacaagaggcacatgcaggaggtgctcatcgaccagggcatgctaaccacgctg
gcgatgtggctcaagccgatgccagacggatccctcgtctcgctgcaagtgcggaccgac
ctgctgcgcgtgctcgggctgctcgaggtcgacgagacggtcctcggctcgctgcgctcc
tcgtccctcggaaagtacgcccgcctctactcgctctccacaagaaggagtgaccgcttg
ggacccttctcggaaccttctcggaaccttctcctaggtacgtccgcctctactcgctcc
acaagaaggagaccgcagcgaaccggcacacggcgacggcgctcgttgagaagtggaaga
ggccaatcttcggctctaccaccgccttccaggccgagaacgtgccgcagcggcgcggcc
agaccgcggaggatctcgagaggaaggcgatggcgcgcgtgg

DBGET integrated database retrieval system