KEGG   Emiliania huxleyi: EMIHUDRAFT_461628Help
Entry
EMIHUDRAFT_461628 CDS       T02915                                 

Definition
(RefSeq) Selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00450  Selenocompound metabolism
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EMIHUDRAFT_461628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ehx03016]
    EMIHUDRAFT_461628
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     EMIHUDRAFT_461628
Transfer RNA biogenesis [BR:ehx03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    EMIHUDRAFT_461628
 Prokaryotic Type
    EMIHUDRAFT_461628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 17261128
NCBI-ProteinID: XP_005767273
JGI: Emihu1_461628
UniProt: R1E1L5
Position
Unknown
AA seq 831 aa AA seqDB search
MLLVRPTLDAAWPAIAALGAVGAIVAGPRLARWAAVRLQLLFVHISLLRLSEGGSVFSSW
RGVAAWPLVQYELFKLLSLEASHRLDSFGHVDTGVKRGGGRRWWWPFAAAGGGGGMGGGG
GMSGGMVIKDLVLVGGGHSHVHVLKMFGMQPQPGVQLTLITRDVDTPYSGMLPGYVAGAY
SRRECHIDLARLAAFAGARLIHAEATGVDTRARPPQPLREAAVARSADACVTPVKPIDGF
CARWDAILARTFSAAANAAAPPVRVVVVGGGAGGVELALAMEARLTRRHSRRAEARPLRR
RLVESGAAKARAKVARAGRVRAASTPLQLDERGFVAVGETLESVSAAAVFAAGDVAAVLK
HPRPKADVLARAQAGVFAVRQGPPLATNLRRKLLGKPLLPFTPQDRFLGIIGTGDGGAVA
SKGPLCLEAPWLWGTWRGLELARDDQGCLPQMDAAPDASAVPEVAAAAGDEALRTLSHAS
MRCGGCGAKVGATVLSRVMARLRAEGHLPEARHHTVLVGLEAPDDCAVLAPSSMPSVHSV
DFFRSFLPDPFVFGQVAANHALSDCHAMGAPPAGALAVAVVPYGLEAKATLFQMMAGACR
TLGEAGCALLGGHTCEGAELALGFAVIGYAPKEAMMHKGGMRAGDALLLTKPLGTGVLFA
AAMRGAAPGAALAAATEGMVRSNAPAAEALIRHGGNACTDVTGFGLLGHLLEMASASNAR
VRLRLGDVPILPGVEECIGQGIFSSLQPANLRLRRAISNEAQAVQHPAYPALFDPQTAGG
LLSSVPADRAEACVRELRALGFTSAAVIGEVTEVLTPEEACPASLIDVAVD
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggttcgacccacgctcgacgctgcctggccggccatcgccgcgctaggcgcc
gtaggcgccatcgttgcaggaccgcggctggcccgatgggccgcggtgaggctgcagctc
ttgtttgtgcacatctcgctgctccgtctgtcagagggcggctccgtcttctcttcgtgg
cgcggcgttgccgcgtggcccctggtgcagtacgaactgttcaagctcctgtcgctcgag
gcctcgcatcgcctcgactcgtttggtcacgtcgacacaggcgtcaagcggggcggcggg
aggcgctggtggtggccgtttgccgcggcaggaggcggcggcgggatgggcggcggcggc
gggatgagcggcgggatggtgataaaggacctggtcctcgtcggcggcggccactcccac
gtgcacgtcctcaagatgtttggcatgcagccgcagccgggcgtgcagctgacgctcatc
acgcgggacgtcgacacgccttactcggggatgctaccagggtacgtggccggcgcgtac
tcgcggcgagagtgccacatcgacctcgcgcggctcgcggcctttgccggcgcgcgactc
atccacgccgaagcgaccggcgtggacactcgcgccaggccgcctcagccactgcgcgag
gcggccgtggcgcgctccgccgacgcgtgcgtcactccggtcaagccgatcgacggcttc
tgcgcgcgctgggacgcgatcctcgcccgcactttctccgccgccgccaacgccgcggcg
ccgccggtgcgggtcgtggtcgtcggcgggggcgcgggcggcgtcgagctggcgctggcg
atggaggcgcgactgacgaggcgccactcgcggcgggccgaggcccgtcccttgaggcgt
cggctcgttgagtcaggcgcggctaaggcgcgagctaaggtcgcgagggcgggacgcgtc
cgcgctgcgagcacgccgctgcagctcgacgagcgcggcttcgtcgccgtgggagagacg
ctcgagtcggtcagcgccgccgccgtgtttgccgccggcgacgttgccgccgtgctcaag
cacccgcggccaaaggcggacgtcctcgctcgcgcgcaggcgggcgtctttgccgtgcgg
caagggccgcccctcgccaccaatttgcggcgcaagctgctcggcaagccgctgctgccc
ttcacgccgcaggaccgcttcctgggcatcatcggcacgggcgacggcggcgcggtcgcc
tccaaaggaccgctctgcctcgaggcgccgtggctgtggggcacctggcgagggctggag
ctcgcccgagacgaccaaggctgccttccgcagatggacgccgcgccagacgcgagcgcc
gtgcccgaggtggcggcggcggcgggcgacgaggcgttgcgcacgctctcgcacgcgtcg
atgcggtgcggcggctgcggtgcaaaggttggcgcgacggtgctctcgcgggtgatggcg
cggctgcgcgcggagggccatttgcccgaggcgaggcaccacactgtcctcgtcgggctc
gaggcgccggacgattgcgccgtcctcgcgccgtcgagcatgccgtccgtccactccgtc
gacttcttccgctccttcctgcccgaccccttcgtgttcgggcaagtggccgccaaccac
gccctctccgactgccacgccatgggcgcgccgcccgccggtgccctcgcggtggcggtc
gtcccgtacgggctcgaggcgaaggcgacgctcttccagatgatggcgggcgcctgccgc
acgctcggcgaggcggggtgcgcgctactcggcggacacacgtgcgagggcgcagagctc
gccctcggcttcgccgtcatcgggtacgcgcccaaagaggcgatgatgcacaagggtggc
atgcgggccggcgacgcgctcctcctcacaaagccgctcggcacgggcgtcctcttcgcc
gcggcgatgcgcggcgccgcgcccggcgcggccctcgccgcggcgaccgaggggatggtg
cgctcgaatgcgcccgcggcggaggcgctgatccgccacggaggcaacgcgtgcaccgac
gtgaccggctttgggctgctcggccacctgctcgagatggcgtccgcctcaaatgcgcgc
gtccggctgcggctcggcgacgtgccgatcctgcccggcgtcgaggagtgcatcggccag
ggcatcttctcgtcgctgcagcccgccaacctgcggctgcggcgcgcaatctccaacgag
gcgcaggcggtgcagcaccccgcgtaccccgccctcttcgacccgcagaccgccggcggg
ctcctctcgtcggtgccggctgaccgggccgaggcgtgcgtgcgggagctgcgcgctctc
ggtttcacgtctgccgcggtgattggcgaggtgaccgaggtgctcacgcccgaggaggcg
tgccccgcgtcgctcatcgacgtcgccgtcgactga

DBGET integrated database retrieval system