KEGG   Emiliania huxleyi: EMIHUDRAFT_462832Help
Entry
EMIHUDRAFT_462832 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
ehx  Emiliania huxleyi
Pathway
ehx03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EMIHUDRAFT_462832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ehx03032]
    EMIHUDRAFT_462832
   03036 Chromosome and associated proteins [BR:ehx03036]
    EMIHUDRAFT_462832
   03400 DNA repair and recombination proteins [BR:ehx03400]
    EMIHUDRAFT_462832
Enzymes [BR:ehx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     EMIHUDRAFT_462832
DNA replication proteins [BR:ehx03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     EMIHUDRAFT_462832
Chromosome and associated proteins [BR:ehx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    EMIHUDRAFT_462832
DNA repair and recombination proteins [BR:ehx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     EMIHUDRAFT_462832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg SAP zf-PARP WGR PADR1 BRCT
Motif
Other DBs
NCBI-GeneID: 17276348
NCBI-ProteinID: XP_005783504
JGI: Emihu1_462832
UniProt: R1EWW5
Position
Unknown
AA seq 1120 aa AA seqDB search
MSYGGDDSSIPDKLRLDYAPTSRASCKGCGRGIGQGEVRCGVKVRSQWHDGFDMHFHHVA
CAPKASGPGAFKGVQRLRWADQAALADALKMPLDESKPAVKKAKRLNELVWGVVDKVASV
PKKQLREALEENDRFITDKMSPAELAYMIGDSLVSGLLPPCPFCECNALVGEGGMIRCAG
FAAGTTSCRFSLVLDSVFDEPLGSEEMRGRTKRAGVFEPTQPLARALKDWSPPKDAPVLA
LAPAAGAAGGSAAAGPSGVNIQGSGTDVQGGGPNVEPFHGDLHGDIDSGDDEELDGSCDA
KYVMAGLVVASVGSTTPKAEEIQSIVEAHGGEWVSGSIGDGRSVSILVSTEAEAAKKKPS
AKFAAAAKAGVPAVSADYILALAGLPPATGSSKSTGKSTGKSGGGGKSGGGKSGGKARGK
RAAAAIDLTGDSSDEEAAEADAPMSEAELAAEQVSGMRVPELRAELETRGLATGGNKPQL
VQRLRQAVQAEEAARSEQAYDAAQATGAPSEAAAAPPSKRAKTGASSSAASSAAGASGGA
PAAARAGASGLVLRRRREMAAYLLDPDGERGPPLPFLKGSITRAQLAEKRKAKSSKGPRK
VLPLVAQGSALATAWHSVLNAVDLADGTNKYYKMQLLQTGSSYCVYRAWGRVGGGGAGGK
SGGGKSKSVPGYLNSDVVHEHGVDLDGAKKEFREQFKKLAKCDFEWCEPPVQHPSGYAVT
LLPGQLSDEATGEAAAGGGGKSASGSAMGSSLPPPVARFVSLIGDKKMMAAQLQEMHVDL
EKMPLGSISTAQIKRGYEALTRVATQLQTPAADGDEQKHRLLTLTTHFYTTIPHKFGLDE
VPPVIDSLPMLKDKLDMVEALLQVQESQKLSKSLGPAAEQHPLDAMYAQLQCGLAPASEA
EHEMVRRYAANTHGSTHDTYKINVKDVLAVSRAAEQPGFKASLANRQLLWHGSRLTNWAG
ILSQGLRIAPPEAPVTGYMFGKGVYFADMSSKSANYCGATSANPTAVLLLCDVALGSQYE
RLNAEYEAAESCKKAGKASTWGVGKFAPADGGASSIEGGAIRVPMGEAGDSEYMKANFAR
LQKAEGGKARAALLYNEYIVYDVSQIQMKYVVVCELEFDG
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacggcggcgacgactcctccatcccggacaagctccggctcgactacgcgccc
accagccgcgcgtcctgcaagggctgcggccgcggcatcggtcagggcgaggtccgctgc
ggcgtcaaggtgcgctcgcagtggcacgacggcttcgacatgcacttccaccacgtggcg
tgcgcccccaaggcctccgggcccggcgccttcaagggcgtgcagcggctgcgctgggcc
gatcaggcggcgctcgccgacgccctcaagatgccgctcgatgagagcaagccggcggtg
aagaaggcgaagcggctcaacgagctggtctggggcgtggtcgacaaggtggcgagcgtg
cccaaaaaacagctgcgcgaggcgctcgaggagaacgatcgcttcatcaccgacaagatg
tcgcccgccgagctcgcctacatgattggcgactcgctcgtgtccgggctgcttccgccg
tgcccgttctgcgagtgcaatgccctggtgggggagggcgggatgatccgctgcgccggc
ttcgccgccggcaccacctcctgccgcttctcgctcgtcctcgactccgtctttgacgag
ccgctcggctcggaagagatgcgcggccgcaccaagcgagcgggcgtgtttgagcccacg
cagccgctcgcgcgcgcgctcaaggactggtcgccgccgaaggacgcgccggtgctggcg
ctcgctccggcagccggtgcggccggcggcagcgccgccgccggcccgagcggcgtcaac
atccaaggcagcggtacggacgtccaaggcgggggccccaacgtcgagccgttccatggc
gatctgcatggtgatatcgactcgggggacgacgaggagctggacgggtcgtgcgacgca
aagtacgtgatggcggggctcgtcgtggcgtcggtcggctcgacgacgcccaaggccgag
gagatccagtccatcgtcgaggcgcacggcggcgagtgggtctcgggctccatcggcgac
ggccgctcggtctccatcctggtctcgaccgaggcggaggcggccaagaagaagccgtcg
gcaaagttcgcggcggcggccaaggcgggcgtgccggccgtctctgccgactacatcctc
gcgctcgcgggcttgccgcccgcgaccggctccagcaagagcaccggcaagagcacgggc
aagagcggcggcggcggcaagagcggcggcggcaagagcggcggcaaggcgcgcggcaag
cgcgcggcggcggcgatcgacctgacgggggacagcagcgacgaggaggcggccgaggcg
gacgcgccgatgagcgaggcggagctggccgccgagcaggtgagcggcatgcgcgtgccg
gagctgcgcgcggagctcgagacgcgcgggctcgcgacgggcggaaacaagccgcagctc
gtgcagcggctgcggcaggcggtgcaggcggaggaggcggcgcgctccgagcaggcgtac
gacgcggcgcaggcgacaggcgcgccgtccgaggcggccgctgcgcccccgagcaagagg
gcaaagaccggcgcgtcctcctccgccgcctcgtcggcggcgggcgcgagcggcggcgcc
cccgccgcggcgcgggcgggcgcgagcgggctggtgctgcggcggcggcgcgagatggcg
gcgtacctcctcgacccggacggagagcgcgggcccccgctgccctttctgaagggttcg
atcacgagggcgcagcttgccgagaagcgcaaggccaagtcgagcaaggggcctcgcaag
gtgctgccgctcgtcgctcagggctccgctctcgcgacggcgtggcattcggtcctcaac
gcggtcgacctcgccgacggcacaaacaagtactacaagatgcagctgctgcagacgggc
tcctcgtattgcgtctaccgcgcgtggggccgcgtcggcggcggcggcgcgggcggcaag
tcaggcggaggcaagagcaagtcggtgccgggctacctcaactcggacgtcgtccacgag
cacggcgtcgacctcgacggcgccaagaaggagtttcgcgaacagttcaagaagctcgcc
aagtgcgactttgagtggtgcgagccgccggtgcagcaccctagcgggtacgcggtcacg
ctgctgccgggccagctctccgacgaggcgacgggcgaggcggcggcgggcggcggcggc
aagtcggccagcggctccgcgatgggctcgtcgctgccgccgccggtagcgcggttcgtg
tctctgatcggcgacaagaagatgatggctgcgcagctgcaggagatgcacgtcgacctc
gaaaagatgcctctcggctccatctcgacggcgcagatcaagcgcggctacgaggcgctc
acgcgcgtcgcgacgcagctgcagacgccggcggcagacggcgacgagcagaagcaccgg
ctgctcacgctgacgacgcacttctacacgacgatcccgcacaagttcggcctcgacgag
gtgccgcccgtcatcgactcgctgccgatgctcaaggacaagctcgacatggtcgaggcg
ctgctgcaggtgcaagagtcgcagaagctctcgaagagcctcggcccggccgccgagcag
cacccgctcgacgctatgtacgcgcaactccagtgcgggctcgcgccggcgtcggaggcg
gagcacgagatggtccggcggtacgcggccaacacgcacggctcgacgcacgacacgtac
aagatcaacgtcaaggacgtgctcgccgtctcgcgcgcggccgagcagccgggcttcaag
gcgtcgctcgccaaccggcagctgctgtggcacggctcgcgcctgaccaactgggcgggc
atcctctcgcaggggctgcgcatcgcgccgcccgaggcgcccgtcacgggctacatgttt
ggcaagggcgtctacttcgcagacatgagctccaagtcggcaaactactgcggcgccact
tccgccaacccgaccgccgtcctgctgctctgcgacgtcgctctcggctcgcagtacgag
cggctcaacgcagagtacgaggcggcggagagctgcaagaaggcgggcaaggcgtcgact
tggggcgtgggcaagttcgcgcccgccgacgggggcgcgagctcgatcgagggcggcgcg
atccgcgtgccgatgggcgaggcgggcgactccgagtacatgaaggccaacttcgcgcgg
ctgcaaaaggcggagggcggcaaggcgcgggcggctctcctctacaacgagtacattgtc
tacgacgtctcgcagatccagatgaagtacgtagtcgtgtgcgaactcgagttcgacggc
tga

DBGET integrated database retrieval system