KEGG   Emiliania huxleyi: EMIHUDRAFT_471229Help
Entry
EMIHUDRAFT_471229 CDS       T02915                                 

Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ehx  Emiliania huxleyi
Pathway
ehx03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EMIHUDRAFT_471229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ehx03041]
    EMIHUDRAFT_471229
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EMIHUDRAFT_471229
Spliceosome [BR:ehx03041]
 Complex C
  Other components
   Step II factors
    EMIHUDRAFT_471229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA_14 ABC_tran TrwB_AAD_bind PhoH AAA_16 Sigma54_activ_2 AAA_25 ResIII NACHT SRP54 ATPase DAP3 Flavi_DEAD AAA_24 NB-ARC
Motif
Other DBs
NCBI-GeneID: 17252032
NCBI-ProteinID: XP_005758312
JGI: Emihu1_471229
UniProt: R1B8C0
Position
Unknown
AA seq 748 aa AA seqDB search
MSPIKIVRNPDGSLQRAAMTQSALAKERRELRDSQQRALMDAIPKDLNRPWEDPMPEPGE
RHIAQELRGLGYTQEAVPEWKVKSMGKGFSIGFPTKNKSIQEQRASLPIAALKQELVNAV
AENQVLVVIGETGSGKTTQMTQFMAEAAGFTSRGIIGCTQPRRVAAMSVAKRVAEEFGCR
LGQEVGYSIRFEDCTSPETILKYMTDGMLLRECLVDTNLSRYSLIMLDEAHERTIHTDVL
FGLLKGLLARRKDLKLICTSATLDAEKYSSYFFECPIFTIPGRTFPVEVLYTKAPEADYM
DAALITVMQIHLQEPPGDVLLFLTGQEEIDTACQILFERMKSLGPRIFEAAPPGSRKVVI
ATNIAEASLTIDGIFYVVDPGFVKQKVYNAKVGMDSLVVVPISQASARQRSGRAGRTGPG
KCYRLYTEQATSPYLPAYKNEMLPTNVPEIQRTNLGNTVLQMKAMGVNDLLHFDFMDAPP
VQTLVAAMEALYALSALDEEGLLTRLGRRMAEFPLEPPMSKILIASVELGCSDEVLTVVA
MLSVQNIWYRPKEKQAQADQKRSKFFQAEGDHITLLAVYQGWAAAKFSNPWCFENFIQAR
NMRKAQDVRKQLLTIMDRYKLEIETCGRNFTKVRKAITSGYFTHAAKKDPQEGYKTMDEG
QVVYIHPSSALFNRNPEWCIYHELVLTSKEYMRECMAIEPKWLTELAPRYYQQADPRHLS
KRKRNERIEPLYDRFNDPNAWRLSKRRG
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgatcaagatcgtccgcaaccccgacggctcgctgcagcgcgccgcgatgacg
cagtcggctctggccaaggagcggcgcgagctgcgcgactcgcagcagcgagcgctgatg
gacgcaatccccaaggacctcaaccggccgtgggaggacccgatgccggagccgggagag
cggcacatcgcgcaggagctgcgcggcctcggctacacgcaggaggcggtgccggagtgg
aaggtcaagtcgatgggcaagggcttctcgatcggtttcccgaccaagaacaagtcgatc
caggagcagcgcgcctcgctgccgatcgcggcgctgaagcaggagctggtgaacgccgtc
gcggagaaccaggtcctcgtcgtgattggcgagacgggctccggcaagacgacgcagatg
acgcagttcatggccgaggcagcgggcttcacgtcgcgcggcatcatcggctgcacgcag
ccgcgccgcgtcgccgcgatgtcggtcgccaagcgagtggccgaggagtttggctgccgg
ctgggccaggaggttggctattcgatccggttcgaggactgcacgtcgcccgagacgatc
ctcaagtacatgactgacgggatgctgctgcgcgagtgcctcgtcgacaccaacctgtcg
cgctactcgctcatcatgctggacgaggcgcacgagcgcacgattcacactgacgtcctc
ttcggcctgctcaagggcctgctcgcccgccgcaaggacctcaagctcatctgcacttcg
gcgaccctcgacgcggagaagtactcgtcctacttcttcgagtgcccgatcttcaccatc
cccggccgcaccttcccggtcgaggtcctctacacaaaggcgcccgaggcggactacatg
gacgcggccctcatcacggtgatgcagatccacctgcaggagccgcccggcgacgtcctc
ctcttcctcacggggcaggaggagatcgacaccgcctgccagatcctctttgagcggatg
aagtcgctcggcccgcgcatcttcgaggccgcgccgcccggctcgcgcaaggtggtcatc
gcgacaaacatcgccgaggcatccctcacgatcgacggcatcttctacgtcgtcgacccc
ggcttcgtcaagcagaaggtgtacaacgcaaaggtcggcatggactcgctggtggtggtg
ccgatctcgcaggcgtcggcgcggcagcggtcggggcgcgctggccgcaccggcccgggc
aagtgctaccgcctgtacaccgagcaggcgacctccccatatctccccgcgtacaagaac
gagatgctgcccaccaacgtgccggagatccagcgcacgaacctgggcaacaccgtgctg
cagatgaaggcgatgggcgtcaacgacctgctccacttcgactttatggacgcgccgccc
gtgcagacgctcgtcgcggcgatggaggcgctgtacgcgctctctgccctcgacgaggag
gggctgctcacgcgcctcggccgccgcatggccgagttcccgctcgagcctccgatgtcc
aagatcttgatcgcctcggtcgagctgggctgctccgacgaggtgctcacggtggttgcg
atgctctccgtccaaaacatctggtaccgcccgaaggagaagcaggcgcaggcggaccag
aagcgctccaagttcttccaggcggagggcgaccacatcacgctgctcgccgtctaccaa
ggctgggcggcggccaagttctcaaacccgtggtgcttcgagaacttcatccaggcgcga
aacatgcgcaaggcgcaggacgtgcgcaagcagctgctcaccatcatggaccggtacaag
ctggagatcgagacgtgcggccgcaacttcacaaaggtgcgcaaggcgatcacgtcgggc
tacttcacgcacgcggccaagaaggacccgcaggagggctacaagacgatggacgagggc
caggtcgtgtacatccacccctcctccgcgctcttcaaccgcaaccccgagtggtgcatc
taccatgagctcgtcctaacctccaaggagtacatgcgcgagtgcatggccatcgagcca
aagtggctcaccgagctcgcgccgcgctactaccagcaggccgacccgcgccacctctcc
aagcggaagcgcaacgagcgcatcgagccgctgtacgaccgcttcaacgaccccaacgcg
tggcgcctctccaagcggcgcggctga

DBGET integrated database retrieval system