KEGG   Emiliania huxleyi: EMIHUDRAFT_557972Help
Entry
EMIHUDRAFT_557972 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
ehx  Emiliania huxleyi
Pathway
ehx04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    EMIHUDRAFT_557972
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ehx03041]
    EMIHUDRAFT_557972
   03110 Chaperones and folding catalysts [BR:ehx03110]
    EMIHUDRAFT_557972
   04121 Ubiquitin system [BR:ehx04121]
    EMIHUDRAFT_557972
Enzymes [BR:ehx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     EMIHUDRAFT_557972
Spliceosome [BR:ehx03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    EMIHUDRAFT_557972
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    EMIHUDRAFT_557972
Chaperones and folding catalysts [BR:ehx03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    EMIHUDRAFT_557972
Ubiquitin system [BR:ehx04121]
 Ubiquitin ligases (E3)
  U-box type E3
   EMIHUDRAFT_557972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Rtf2 zf-NOSIP V-set_CD47
Motif
Other DBs
NCBI-GeneID: 17259631
NCBI-ProteinID: XP_005765924
JGI: Emihu1_557972
UniProt: R1DG82
Position
Unknown
AA seq 551 aa AA seqDB search
MGKKQHSKDQLYITQTEWKKDWGGAKSNKHIPYKVLPFDCCAISLRPFEGSPMCTADGVV
FDLLNIVPYLKKYRRHPVTGGPLAASDLIKLNFHKNSEGKYHCPVMFKVFNQHTHIVAIR
QTGNVFSHEAVKELNLKARSMRDLIDGTPFGKSDIITIQDPSDGSAREIGHFSHVVEGLD
VDHKAGAGVRHNDATARILGKLSSTAAEAAAASAAAASTALTKATGKAPAEGAPSSSRLE
PASKFAKPAAASAAPRWLQTTGEHSAGFTSTALTPVTSNAIAELSEAEASRQRYAFLKKK
KYAQLQTSHGALNLELHADSVPMTCENFLGLAEKGYYDGLAFHRLLRNFMVQGGDPTGSG
SGGVSLWGKPFRDEISNKLRHEGRGVVSMANSGPDSNGSQFFITFKSAAHLDGKHTVFGR
VVGGFDALTRIEAVKTDKEDRPTQAVSISGVNVLVNPFDNLDAEMAEAHEREADPAAAAA
EEKAKRAAEDAQAWYNGPVERPKQLREGVGKYIAAEHLRYGAPAAPPAEGQAAPPKKKLK
GSGGFSDFSAW
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagcagcactcaaaggaccagctgtacatcacccagacagagtggaaaaag
gactggggcggcgccaagtcgaacaagcacatcccctacaaggtgctccccttcgactgc
tgcgccatctcactgcggccgttcgaaggctctcccatgtgcaccgccgacggcgtcgtg
tttgacctcctcaacatcgtcccatacctgaaaaagtaccggcgccacccagtgacgggc
ggccctctggccgcgtcggacctgatcaagctcaactttcacaagaactcggagggcaag
taccactgcccggtcatgttcaaggtcttcaaccagcacacgcacatcgtcgccatccgc
cagaccggcaacgtcttttcgcacgaggctgtcaaggagctcaacctcaaggcaaggtcg
atgcgcgacctcatcgacggcacgcccttcggcaagagcgacatcatcaccatccaggac
ccctcggacgggagtgcgcgcgagatcggccacttctcccacgtcgtcgaggggctcgat
gtcgaccacaaggcgggcgcgggcgtgcggcacaacgacgcgacggcgcgcatcctcggg
aagctctcctcgacggcggcggaggcggcggcggcgtcggcggcggccgcctcgacggcg
ctcaccaaggcgacgggcaaggcgcccgccgagggcgcgccctcctcctcccggctcgag
cccgcctcaaagtttgccaagccggcggccgcgtcggcggccccgcgctggctgcagacg
acgggagagcactcggcgggcttcacttcgacggcgctcacgccggtcacctcgaacgcg
atcgccgagctctccgaggcggaggcgtcgaggcagcgctacgccttcctcaagaagaag
aagtacgcgcagctgcagacgtcgcacggcgcgctcaacctcgagctgcacgccgactcc
gtcccgatgacgtgcgagaacttcctcggactcgccgagaaggggtactacgacggcctc
gcgttccaccggctgcttcgcaacttcatggtgcagggcggcgacccgacgggctcgggg
tcgggcggcgtgtcgctgtgggggaagcccttccgcgacgagatctcgaacaagctgcgc
cacgaggggcgcggcgtcgtctcgatggccaactcggggcccgactcgaacggctcccag
ttcttcatcaccttcaagtcggcggcgcacctcgacggtaagcacaccgtcttcggccgg
gtcgtcggaggcttcgacgcgctcacgcggatcgaggcggtcaagacggacaaggaggac
cggcccacccaggcggtctccatcagcggagtcaacgtcctcgtcaacccctttgacaac
ctcgacgccgagatggcggaggcgcacgagagggaggcggacccggccgccgccgcagcc
gaggagaaggcgaagcgcgccgccgaggacgcgcaggcgtggtacaacggcccggtggag
cggccgaagcagctgcgcgagggggtgggcaagtacatcgccgcagagcacctgcgatac
ggcgcgccggcggcgccgcccgccgaggggcaagccgcgccgccaaagaagaagctcaaa
ggcagcggcggcttctccgacttttccgcatggtga

DBGET integrated database retrieval system