KEGG   Emiliania huxleyi: EMIHUDRAFT_62515Help
Entry
EMIHUDRAFT_62515  CDS       T02915                                 

Definition
(RefSeq) putative cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EMIHUDRAFT_62515
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     EMIHUDRAFT_62515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 17286410
NCBI-ProteinID: XP_005793570
JGI: Emihu1_62515
UniProt: R1FZE7
Position
Unknown
AA seq 271 aa AA seqDB search
MSEPLDHCSSCYLPTSWLALPLLAKKEYNYDSTLYSFGLPEGQSLNLPAARRTVARTTLT
AQTRSARTVSDNSVLGKFDLLIKRYDGGAVSQYLHALPIGAEVSFKHIKFNIKAQYPFAG
KTTFTLIAAGTGIAPMYQALWKLMGTEGDNRKVTLIYGNKSPEDILLKEELDGWASRSAG
RLKIVHVVGNQPDDPAPPGWADTPTYTAETGWVDEAKLKKHAFPPAEDTLVFVCGLPGMY
AALCGPRNEKELKDGSTLQKLGYTADMVAKM
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcccctcgaccactgctccagctgctacctcccgacgtcatggctcgcgctg
ccgctgcttgcgaagaaggagtacaactacgacagcacgctctactcctttggccttccc
gagggccagtcgctcaacctgcccgccgcaaggcggacggtggcaaggacgactttgacg
gctcagacgcggtccgcccgtacggtgagcgacaacagcgtgctgggcaagtttgacctg
ctcatcaagcggtacgacggtggcgccgtctcgcagtacctgcacgcgctgccgatcggt
gccgaggtgagcttcaagcacatcaaattcaacatcaaggcccagtacccgttcgcaggc
aagacgacgttcacgctcatcgccgcgggcacgggcatcgcgcccatgtaccaggcgctg
tggaagctgatgggcaccgagggcgacaaccggaaggtgacgctcatctatggaaacaag
agccccgaggacatcctgctcaaggaggagctcgacggctgggcaagcaggtctgcgggc
cggctcaagatcgtgcacgtcgtcggcaaccagcccgacgacccggcgcctcccggctgg
gccgacacgccaacgtacacggccgagacggggtgggtcgacgaggccaagctcaaaaag
cacgccttcccgcctgcggaggacacgctcgtcttcgtgtgcgggctgccgggcatgtac
gccgcgctgtgcgggccgcgcaacgagaaggagctgaaggacggctccacgctgcaaaag
ctgggctacaccgctgacatggtcgctaagatgtga

DBGET integrated database retrieval system