KEGG   Emiliania huxleyi: EMIHUDRAFT_632218Help
Entry
EMIHUDRAFT_632218 CDS       T02915                                 

Gene name
G6PDH1
Definition
(RefSeq) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00030  Pentose phosphate pathway
ehx00480  Glutathione metabolism
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
ehx01130  Biosynthesis of antibiotics
ehx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EMIHUDRAFT_632218 (G6PDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EMIHUDRAFT_632218 (G6PDH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ehx04147]
    EMIHUDRAFT_632218 (G6PDH1)
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EMIHUDRAFT_632218 (G6PDH1)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EMIHUDRAFT_632218 (G6PDH1)
Exosome [BR:ehx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EMIHUDRAFT_632218 (G6PDH1)
  Exosomal proteins of colorectal cancer cells
   EMIHUDRAFT_632218 (G6PDH1)
  Exosomal proteins of bladder cancer cells
   EMIHUDRAFT_632218 (G6PDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 17260230
NCBI-ProteinID: XP_005766602
JGI: Emihu1_632218
UniProt: R1BVH7
Position
Unknown
AA seq 464 aa AA seqDB search
SVVVFGADGDLASKKILPTLFNLWRRKLVPRDLLVFGFARAPMTTETFRKHIFKCVYHPS
QPQGDRKEFLQRCHYQSGQFDEPEAMEALLRQREEAEAARLAARQQPAGSRPQALHFQDR
RPASASFDAVGAAAEAGVPEEQDTASCQQMVRELSMLREDEIFRIDHYLGKELVMNLLVL
RFANVCFQGIWNRQYIKNVQVIFKEDFGTQGRRGGWVARARGVRHLCHQVMALVAMEQPL
SFSAGDIRAEKLKVLKCVQPLTLDTLCTGQYVRCGNSPGYLEEPTVVDKQSRTETFAAAV
LHVHNPRWEGVPFVLKAGKALTDRKAEVRIQFHNVPGVISDLANSLPANELVVRLQPEET
IYWKVQNKVPGLGFETNQIRMDLLYATKFQQRKLPEARAAAAYERLLLDVLAGQSSNFVS
AEELIHSWAIFTPVLHQLREEKVVPEPYPYGSRGPPGADELASR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
tcggtggtcgtgtttggcgcggacggcgaccttgcgtcgaagaagatcctgccgacgctc
ttcaatctctggcggcgcaagctcgtgccgcgcgacctcctcgtctttgggttcgcgcgt
gcgccgatgacgaccgagaccttccgcaagcacatcttcaagtgcgtttaccacccgtcg
cagccgcagggcgaccggaaggagtttctgcagcgctgccactaccagtctggccagttt
gacgagccagaggcgatggaggcgctgctgaggcaacgggaggaggcggaggcggcgcga
ctcgcagcgaggcagcagcccgcaggcagccggccacaagcactccactttcaggaccgg
cggccggcgtcggcgtcgttcgatgccgtcggcgcggcggccgaggcgggcgtgccggag
gagcaggacacggcttcgtgccagcagatggtgcgcgagttgtcgatgctgcgggaggac
gagatcttccgaatcgatcactaccttggcaaggagctggtgatgaatctgctcgtgctg
cgttttgccaacgtctgcttccagggcatctggaaccggcagtacatcaagaacgtgcag
gtcatcttcaaggaggacttcgggacgcaggggcgccggggtgggtgggtagcgcgagcg
agaggtgtgcgacacctctgccaccaggtgatggcattggtggcgatggagcagccgctc
tccttctccgccggcgacatccgcgccgagaagctcaaggtgctcaagtgcgtgcagccg
cttaccctcgacacgctctgcaccggccagtacgtccgctgcggcaactcgcccgggtac
ctcgaggagccgaccgtcgtggacaagcagagccgcaccgagaccttcgccgccgccgtg
ctgcatgtgcacaaccctcggtgggagggcgtgcccttcgtgctcaaggcgggcaaggca
ctcacggaccgcaaggcagaggtgcggatccagttccacaacgtgccaggcgtcatctcg
gacctcgccaactcgctccccgccaacgagctcgtcgtgcggctgcagcccgaggagact
atctactggaaggtgcagaacaaggtgcctggtctcggtttcgagaccaatcagatccgg
atggacttgctgtacgccacaaagtttcagcagcgcaagctgccagaggcgcgcgcggcg
gcggcgtacgagcggttgctcctcgacgtcctcgcggggcagtcgtcgaattttgtgtcc
gccgaggagctcatccattcttgggccatcttcacgccggtgctgcaccagctgcgcgag
gagaaggtggtgcccgagccatacccatacgggtctcgcggcccgcccggcgccgacgag
ctcgcttctcgt

DBGET integrated database retrieval system