KEGG   Emiliania huxleyi: EMIHUDRAFT_65282Help
Entry
EMIHUDRAFT_65282  CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K08830  renal tumor antigen [EC:2.7.11.22]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ehx01001]
    EMIHUDRAFT_65282
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     EMIHUDRAFT_65282
Protein kinases [BR:ehx01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   EMIHUDRAFT_65282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 17266460
NCBI-ProteinID: XP_005773343
JGI: Emihu1_65282
UniProt: R1EJ61
Position
Unknown
AA seq 145 aa AA seqDB search
MITDEELKLADFGSCRGIYSKQPYTEYISTRWYRAPECLLTDGFYSYKMDMWGIGCVFFE
VLLHVLSLSPLFPGTNELDQVAKIHKILGTPGRATFEKLKKHSNTHIDFNFPHKAHPPSR
PLGCPPSIPLPKPRARATAPPSTSP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgataaccgacgaagagctcaagctggccgactttggctcttgccgcggcatctactcg
aagcagccctacactgagtacatctcgacgcgatggtaccgcgcgcccgagtgcctcctc
acagacggcttctactcctacaagatggacatgtgggggatcggctgcgtcttttttgag
gtgctcttgcacgtgctctcgctctcgccgctctttcccggcacaaacgagctcgaccag
gtcgccaagatccacaagatcctgggcacgccggggcgagcgaccttcgagaagctgaag
aagcactccaatacccacatcgatttcaacttcccgcacaaggcccacccaccgtcacgc
ccgctcggatgccccccttccattccactccccaaacctcgcgctcgcgccaccgccccg
ccgagcacctccccctag

DBGET integrated database retrieval system