KEGG   Emiliania huxleyi: EMIHUDRAFT_78676Help
Entry
EMIHUDRAFT_78676  CDS       T02915                                 

Definition
(RefSeq) FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ehx03110]
    EMIHUDRAFT_78676
Enzymes [BR:ehx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     EMIHUDRAFT_78676
Chaperones and folding catalysts [BR:ehx03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    EMIHUDRAFT_78676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 17256966
NCBI-ProteinID: XP_005763244
JGI: Emihu1_78676
UniProt: R1D8M9
Position
Unknown
AA seq 124 aa AA seqDB search
MGKKQPEADPPVRVETTTEGDGKTYPSHGDALTVHYTGRLAKSDEVFDNSRERAPFSFTL
GAGTVIRGWELGVASMSLGQRATLSISAEAAYGRKGCDQRGNASGTGFIPPNAALIFDVE
LLDI
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagcagccagaggcggaccctccagtgcgcgtcgagacaacaacggaggga
gacggcaagacctacccgagccacggcgatgcgctgacagtgcactacaccggccggctc
gccaagtcggacgaggtcttcgacaactcacgcgagcgcgcgcccttctccttcacgcta
ggggcagggacggtgattcggggctgggagctcggcgtcgcctccatgagcctaggccag
cgcgccacgctgagcatcagcgctgaggcagcctacgggcgcaaagggtgcgatcagcgc
ggcaacgcctctggcacgggcttcatcccgcccaacgccgcgctgatctttgacgtggag
ctcctcgacatc

DBGET integrated database retrieval system