KEGG   Edwardsiella ictaluri: NT01EI_0339
Entry
NT01EI_0339       CDS       T00912                                 

Definition
(GenBank) conserved hypothetical protein, RAQPRD motiff family
Organism
eic  Edwardsiella ictaluri
SSDB
Motif
Pfam: Plasmid_RAQPRD Glyco_hydro_130
Other DBs
NCBI-ProteinID: ACR67581
UniProt: C5BCX5
Position
342113..342454
AA seq 113 aa
MNHPHPVRSLSARIPGITGLLLLATLSTTVQAAEKDELASALRQLDQVQASLERARVAAA
QAAPAEQGRFFFDYRQATSDLNTIRIGIDRYLEPSRSQPRASFVSGNYRRERP
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaaccatcctcatccggtccggagcctgagcgctcgtatcccgggcatcaccggcctg
ctactgttggccacattgtccacgacggtacaagcggcagaaaaagacgagctcgcttcg
gccttgcgccaactggatcaagtgcaagcctcacttgaacgtgcccgcgtagcggcggct
caggccgctcctgctgagcaggggcgtttcttttttgactaccgtcaggctacatccgat
ctgaataccattcgtatcggtattgaccgctatctggagccatcccggtcccaaccacgg
gcttcatttgttagcggtaattatcgtcgggagcgtccctga

DBGET integrated database retrieval system