KEGG   Edwardsiella ictaluri: NT01EI_0344
Entry
NT01EI_0344       CDS       T00912                                 

Definition
(GenBank) hypothetical protein
Organism
eic  Edwardsiella ictaluri
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ACR67586
UniProt: C5BDH0
Position
344131..345060
AA seq 309 aa
MKTRNDIRTGLMVLSLLLLPLVSLVSEPAQADEFMKWERIPLQIPLQVGLERVVFVDKNV
RVGFPPALNGKLRVQSTGGAVYLKADSTFPQTRVQLQDVESGEVILLDVTAGEKGPSEPV
RLVYSGEVNTVSSTTDTRRQAENSDSSIQPGSDVGTQAKRKKVSYGAPIPVLLTRYAAQS
LYAPLRTVEAVPGIRPVNPHLPKRLTTLYPSEAITATPLAAWGVANRVVVAVRLQNTASL
RIVLDPRALQGQFVAATFQHRWLGPVGTPEDTTTVYIVTGMRPESAFIAEPSVVRKAVRT
AKKEISHAD
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaagacccgtaatgatatacgaacagggctgatggtgctgtccctgttgctgttgccg
ctggtctctctggtcagcgaaccggcacaggccgatgagtttatgaaatgggagcgtatt
ccgttgcaaatcccgctgcaggtagggctggaacgggtggtgtttgtggataaaaatgtc
cgggtgggttttcctccggcacttaacggtaagctgcgcgtgcagagtaccggtggagcc
gtctacttgaaggccgatagcacttttcctcagactcgggtgcaactgcaggatgtggaa
agcggtgaggttattcttctcgatgttactgctggtgaaaaaggcccttccgagccagtt
cgtctggtctacagcggtgaggtgaatacggtcagcagtacgaccgatacccgtcgccag
gcagagaacagcgacagcagcatccagccgggcagtgatgtcggtacgcaggcgaagcgt
aaaaaggtatcgtacggtgcccccattccggtattgctgacccgctatgccgcacaaagc
ctgtatgcgccgctgcgcacggtagaagccgtgccgggtatccgcccggtgaatccgcat
ctgcccaaacggttgacaacgctgtatccgtctgaagccataacggccacgccgctggcc
gcctggggcgtggcaaatcgcgtcgtggtggccgtccgtctgcaaaacaccgccagcctc
aggattgttctggatccccgtgccctgcagggacagtttgtggcggctacgtttcagcac
cgctggttggggcctgtgggcacgccggaagataccaccacggtctatattgtgacgggt
atgcggccggagagcgccttcatcgctgagccttccgtggtgcgcaaggctgttcgtacc
gcgaagaaggagatcagccatgcagattaa

DBGET integrated database retrieval system