KEGG   Edwardsiella ictaluri: NT01EI_0354
Entry
NT01EI_0354       CDS       T00912                                 
Name
(GenBank) hypothetical protein
Organism
eic  Edwardsiella ictaluri
SSDB
Other DBs
NCBI-ProteinID: ACR67596
UniProt: C5BDI0
Position
356809..358107
AA seq 432 aa
MDGAVSDKLFYTLGGGSVISQPATRSNMKKLGMDIGWSSDLMCGNFDLKTTVGNQLNGVT
DGFKNLMGDVIQGATGAVASLPAMLIQRANPGLYDMLTNGVLQANVSFDKAQLNCQNMAK
KMMDFSDTSKWTQAAMAEEYKSLVNNGETDAIRADQKYQDADGTSGKKWIGGQIRGGKGQ
KAIRPTYDLVSAGYNMMNSLNVLSSETVSGASCNGGACSKFSNAEEAAQAVVRVLGDRSM
RTCSNALQCTSGDTDDQPGLSVAGTGFAPMLEEATKNNTEQLVKLVNGTVKPTATELAKL
KTGGLPVTANVIRALQRDPDNTALTVRLASELAMSDAVETALLMRRMLTTGMSEPNAQDQ
PLALEDGVHRIDALDREIMALKNEMDLKRELARNSVLTIIERDNERVGTNPMIQQTDNAD
SRFQKLDTPDAE
NT seq 1299 nt   +upstreamnt  +downstreamnt
gtggatggcgctgtctccgacaagttgttttataccttgggcggtgggtcggtgatatcg
cagccggcgacgcgcagcaatatgaaaaaactgggaatggatattgggtggagcagtgac
ctgatgtgcggcaacttcgaccttaaaaccactgttggcaatcagctgaatggggtgaca
gacggatttaagaatcttatgggcgacgttatccagggggctaccggtgcggtcgccagc
ctgccggcgatgcttattcagcgggccaatccgggcctgtatgacatgctgaccaatggg
gtgctgcaggcaaatgtgtccttcgacaaggcgcaactgaactgtcagaacatggcgaag
aaaatgatggatttcagtgataccagcaagtggacccaggcagctatggcggaagagtat
aaatcgctggtcaacaatggagaaacagacgcaatacgtgcggatcaaaaatatcaggat
gctgacggaacctccgggaaaaaatggattggtggtcagattagaggaggaaaagggcag
aaagcgatccggccgacatatgatttagtatctgcaggttacaacatgatgaatagtctt
aacgtactaagttcagaaactgtgagtggtgccagttgtaacggtggtgcctgcagtaag
ttcagtaatgctgaagaagctgcacaagctgtggtgagagttcttggtgatcgctcaatg
cgcacctgtagcaatgcgttgcagtgtaccagtggcgataccgacgatcagcccggcctg
tccgtcgctggcaccggatttgcgccgatgctggaagaagccacaaagaacaatacggag
caactggtgaaactggtcaatggtaccgtaaaacccacagctactgaactggcgaaactg
aaaacgggtgggttgccggtaacggccaatgtcattagggctctgcaacgagatccggat
aatactgcgctgaccgttcgtcttgccagtgagcttgccatgtctgatgcggtcgaaact
gcactattgatgcgtcggatgctgacaacaggtatgagtgagccaaatgcccaggatcaa
ccgctcgcgctggaagatggtgttcaccggatcgatgctctcgatcgcgaaattatggca
ttgaagaatgaaatggacctgaagcgtgagctggcgaggaactcggtactgaccatcatt
gaacgggacaacgaacgtgtcggtacaaacccaatgattcagcagacggacaatgccgac
agccggttccagaagctcgatacccctgatgcagagtaa

DBGET integrated database retrieval system