KEGG   Edwardsiella ictaluri: NT01EI_0684
Entry
NT01EI_0684       CDS       T00912                                 

Definition
(GenBank) xanthine dehydrogenase, Fe-S subunit, putative
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eic  Edwardsiella ictaluri
Pathway
eic00230  Purine metabolism
eic01100  Metabolic pathways
eic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NT01EI_0684
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACR67906
UniProt: C5B7M9
Position
complement(670113..670601)
AA seq 162 aa
MNVKEWVEIRCQINGKTYQFCVSPAISLLEMLREHGLTSVKQGCCVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTAEGLGRADSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQHEEEEQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagagtgggttgagatccgctgccagatcaatgggaaaacctatcagttt
tgcgtgtcgccggcgatatcactgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgctgcgtcggtgagtgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtatctggcgctgtgggcagatggtaagcaaatcgtcacggccgaa
ggactgggccgagccgacagcctttctccgatccagcaggcctatgtcgacgccggcgct
gtgcagtgcggtttctgtactccgggactggtggtcgcgacccatgccctgctggcaaaa
ccgcgcagtcgcccgctgacgcatcaagagatccgccgcggcctctccggcaacctgtgc
cgctgtaccggctatcaggccatcgtacgcgccgtcgatctctgccagcacgaagaagag
gagcagtag

DBGET integrated database retrieval system