KEGG   Edwardsiella ictaluri: NT01EI_0695Help
Entry
NT01EI_0695       CDS       T00912                                 

Definition
(GenBank) Protein of unknown function (DUF525)
  KO
K06195  ApaG protein
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    NT01EI_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACR67917
UniProt: C5B7P0
Position
complement(683064..683441)
Genome map
AA seq 125 aa AA seqDB search
MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQLLRRYWLITNGNGRQT
EVQGEGVIGEQPLIQPNGEFQYTSGAIIETPCGTMEGHYEMVDHQGHTFRIAIPVFRLAI
PSLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgcaccccgtatcatcgttcaggtacagagtgtctatgctggatcacagtcg
ctgcctgaagaggcgcgcttcgtctttgcctataccgtcactctgcgtaatctgggccgc
tttaacgtacagctcctgcgccgctactggctaataaccaacggcaacggccgccagact
gaagtccagggcgaaggggtcatcggcgaacagccgctgatccagcccaatggtgagttt
cagtacaccagcggcgccatcatcgaaacgccctgcggtaccatggaggggcactacgaa
atggttgaccatcagggacacaccttccgtatcgccattccggtcttccgcctggccatt
cccagcctgattaactga

DBGET integrated database retrieval system