KEGG   Edwardsiella ictaluri: NT01EI_0830Help
Entry
NT01EI_0830       CDS       T00912                                 

Definition
(GenBank) tRNA pseudouridine synthase C, putative
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eic03016]
    NT01EI_0830
Enzymes [BR:eic01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     NT01EI_0830
Transfer RNA biogenesis [BR:eic03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    NT01EI_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 TauD
Motif
Other DBs
NCBI-ProteinID: ACR68046
UniProt: C5BHB0
Position
829818..830609
Genome map
AA seq 263 aa AA seqDB search
MQIIYQDDHLVAVNKPAGWLVHRSWLDRKEKVVVMQTVRDMIGRHVYTVHRLDRPTSGVL
LLGLSSEIARALAQQFEQHQIHKVYHAVVRGYLQGEALLDYPLTPELDKIADRFRSPDRA
PQPAQTYYRGLATAEVPLAIGRYPTSRFSLVELRPQTGRKHQLRRHMAHLRHPIIGDTAH
GDLRQNRGIAVHFDTPGLMLHASELCLTHPVSGEALCLRAGLDLRWQALMDGLGWQTYLP
ELDRVEFIPDCLQDRADETESGQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattatttatcaggatgatcatctggtggcagtcaataagcctgccgggtggttg
gttcaccgcagctggctggatcgtaaagagaaggtggtggttatgcagacggtgcgcgat
atgatcgggcgccatgtctataccgtccatcgcctggatcggccgacttccggggtgctt
ctgctggggctatcgagcgagattgcgcgcgcgctggcccagcaatttgaacagcatcag
atccataaagtctatcatgcggtggtccgcggttatttgcagggagaggcgctgcttgac
tatccgttgacaccggagttggataaaatcgccgatcgtttccgctcccccgatcgtgcc
ccgcagccagcgcagacctactaccgggggctggcaacggcggaggtgccgctggccatt
ggccgttatccgacgtcgcgctttagcttggttgagctgagaccgcagaccggccgtaag
catcagctgcgccgccatatggcacacctgcgccatccgatcatcggtgataccgcgcac
ggcgatctgcgccagaatcgcggcatcgccgtccattttgatacgcccggtttaatgcta
cacgccagcgaactgtgcctgacgcatccggtgagcggtgaggcgctgtgtctacgggca
ggcctggatctgcgctggcaggcgctgatggacgggttgggctggcaaacctatctccct
gagcttgatcgggttgagtttatacccgattgccttcaggatagagcggatgagactgag
agcggtcaatag

DBGET integrated database retrieval system