KEGG   Edwardsiella ictaluri: NT01EI_0993Help
Entry
NT01EI_0993       CDS       T00912                                 

Definition
(GenBank) Oxygen-insensitive NAD(P)H nitroreductase, putative
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00633  Nitrotoluene degradation
eic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NT01EI_0993
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     NT01EI_0993
  1.-  
   1.-.-  
    1.-.-.-  
     NT01EI_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ACR68206
UniProt: C5BBH1
Position
984996..985649
Genome map
AA seq 217 aa AA seqDB search
MDIISAAQSRYSTKVFDADRKLSRGDLDSVKALLRLSPSSTNSQPWHFILAGSDAGKARI
ASTTVGSYEFNRCKVLEASHVVVFCAKTEIDEAYLQRLLQQEQADGRFATPQAMEAQHKG
RAYFASMHRDTLQDAGQWMTRQVYLNLGNFLLGLAALHIDAVPIEGFDSAALDAEFGLPQ
QGLTSVVLVALGYHSAEDFNAALPKSRLPLSEILTEC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttctgcggcgcaatcacgctactcaaccaaggtgtttgacgctgaccgg
aaactcagccgcggcgatctcgacagcgttaaggcgctgctgcgtttgagcccctccagc
accaactcccagccgtggcactttattctggcaggcagcgatgccggtaaggcgcgcatt
gccagcacgacggtgggctcctatgagttcaaccggtgtaaggtgctggaggcctcgcac
gtcgtggttttctgcgcgaaaacggagatagacgaagcctatctgcagcgtctgctgcag
caggagcaggccgatggccgctttgcgacgccgcaggcgatggaggcacagcataaaggg
cgcgcctactttgcctcaatgcaccgcgatacgctgcaggatgccgggcagtggatgacc
aggcaggtctaccttaacctgggcaactttctgctggggctggcagcgctgcatatcgac
gccgtgccgatcgaagggtttgacagcgccgcgctggatgccgaattcggcctgccgcag
caggggctgaccagcgtggtgctggtggcgctgggctaccacagcgcagaggactttaac
gccgcgctgcccaagtcccgtctgccgctgtcagagatcctgaccgagtgctga

DBGET integrated database retrieval system