KEGG   Edwardsiella ictaluri: NT01EI_1377
Entry
NT01EI_1377       CDS       T00912                                 

Definition
(GenBank) Protein of unknown function (DUF1379)
  KO
K18657  cell division protein ZapC
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eic03036]
    NT01EI_1377
Chromosome and associated proteins [BR:eic03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    NT01EI_1377
SSDB
Motif
Pfam: ZapC DUF3404
Other DBs
NCBI-ProteinID: ACR68567
UniProt: C5BD72
Position
1365792..1366349
AA seq 185 aa
MNIKPGDRWCWFFDRQHDRLMLDLANGMVFRSRFPSKMLTPDAFDASSFCVDDAASYYHF
AERCQASGLDTAQCAELVLNALVAQRFLKPIMPKSWYFTPQPGRYVPEMGELVGVQLLDT
PDWGRLLVIAPGASASLCLLAQPSLALAGKRLMLGEAIKVMHDRLLPLSTHPETLSDDTT
LACAG
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaatataaagcccggagatcgctggtgctggttttttgatcggcagcacgatcgtctg
atgttggatctggcgaatggcatggtcttccgctcccgctttccctctaaaatgctgacg
ccagatgcctttgatgccagtagcttttgtgtcgatgatgccgcaagctactaccatttt
gccgagcgctgtcaggcgagtgggctggatacggcgcagtgtgccgagctggtattgaat
gccctggttgcgcagcgcttcctgaaaccgataatgccaaaaagctggtactttacgccg
cagccgggtcgctatgtgcctgagatgggagagctggtcggtgtgcagctgctcgatacg
cccgactggggacgcctgctggtgattgcgccgggcgccagtgccagcctgtgtctgttg
gcccagccctcgctggcgctggccggtaagcggctgatgctgggagaggcaatcaaggtg
atgcatgaccgtttgctgccgctgagtacgcatccggagacgctgtctgacgacaccacg
ctggcctgcgcaggataa

DBGET integrated database retrieval system