KEGG   Edwardsiella ictaluri: NT01EI_1607Help
Entry
NT01EI_1607       CDS       T00912                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase, putative
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00030  Pentose phosphate pathway
eic00480  Glutathione metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
Module
eic_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eic_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
eic_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NT01EI_1607
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NT01EI_1607
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eic04147]
    NT01EI_1607
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NT01EI_1607
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NT01EI_1607
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NT01EI_1607
  Exosomal proteins of colorectal cancer cells
   NT01EI_1607
  Exosomal proteins of bladder cancer cells
   NT01EI_1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N AAA_18 HetR_C
Motif
Other DBs
NCBI-ProteinID: ACR68791
UniProt: C5B9U0
Position
1569468..1570940
Genome map
AA seq 490 aa AA seqDB search
MAVTSTAQACDLIIFGAKGDLARRKLLPSLYQLEKAGHIHPETRIIGVGRAEWDAAAYRK
VVREALDTFLKEPLDDALWQRLSARLDFCNLDVNDTEHFQRLAERVEPQQRVTINYFAMP
PSTFGAICQGLGHAGMNLQPSRIVMEKPLGTDLASSQAINDQVARYFDENQVYRIDHYLG
KETVLNLLALRFANALFANNWDNSMIDHVQITVAEEVGIEGRWGYFDQAGQMRDMVQNHL
LQILTMIAMDPPADLSTDRIRDEKVKVLRSLRRINHSNVRETTVRGQYTAGFVQGQKVPG
YLEEEGANKCSNTETFIAIRVDIDNWRWAGVPFYLRTGKRLPSKCSEVVIYFKNPPLNLF
SDSYQALPQNKLTIRLQPDEGVQIDILNKVPGLEHKHRLQTTKLDLSFSDTFHQEHLADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIMTAWADDNDAPKPYQAGTWGPVSSVALI
TRDGRCWNEF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgtcaacggcacaggcttgcgacctgattatttttggcgccaagggcgat
ctggcccggcgcaagctgctgccttccctgtatcaactggaaaaagctggccatattcac
cccgagacgcgcattatcggcgtcggccgcgccgagtgggatgccgcggcctaccgtaag
gtggtgcgtgaggcgctggatacctttttgaaggagccgcttgacgatgcactgtggcag
cgtctgagtgcccgcctcgacttttgcaacctggacgtcaacgataccgagcattttcag
cgtctggcggagagggtggagccccagcagcgggtgaccattaactattttgccatgccg
ccgagtacctttggcgcgatttgccaggggctgggacatgcggggatgaacctccagccc
agccgtatcgtcatggagaagccgctggggaccgatctggcctcatcgcaggcgattaac
gatcaggtagcgcgctattttgatgaaaatcaggtataccgcatcgaccattatctgggt
aaggagacggtgctgaacctgctggcgctgcgttttgccaacgcgctgtttgccaataac
tgggacaacagcatgatcgaccacgtgcagatcaccgtggcggaagaggtcggcatcgaa
gggcgctggggctattttgatcaggcaggacagatgcgcgacatggtacagaaccatctg
ctgcagatcctgaccatgatcgccatggatccgccagcggacctctccaccgaccgtatc
cgcgatgagaaggtcaaggtgctgcgatccctacgccgcatcaaccacagcaacgtacgt
gagacaacggtgcgcggccagtacaccgccggcttcgtgcagggacagaaggtgccggga
tacctggaagaagagggggcgaacaagtgcagcaatacggaaacctttattgccattcgc
gtcgatattgacaactggcgctgggcaggggtgccgttttatctgcgtaccggtaagcgc
ctgccgagcaagtgctctgaagtggtcatctatttcaaaaatccaccgctgaacctgttc
agcgactcctatcaggcgctgccgcagaataagttgaccattcgcctgcagccggatgaa
ggggtacagatcgatattctgaataaggtgccggggctggagcataaacaccgtctgcag
accactaagctggatctgagcttctccgataccttccatcaggagcatctggcagacgcc
tatgaacgcctgctgctggaggcaatgcgcggtattcaggcgctgtttgtccgccgcgat
gaagtggaagaggcctggaagtgggtcgactccatcatgacggcctgggccgacgacaac
gacgcgccgaagccttatcaggcgggtacctgggggccggtatcttcggtggcgctgatc
acccgcgacggccgttgctggaacgaattctga

DBGET integrated database retrieval system