KEGG   Edwardsiella ictaluri: NT01EI_1693Help
Entry
NT01EI_1693       CDS       T00912                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NT01EI_1693
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     NT01EI_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ACR68874
UniProt: C5BDV1
Position
1654208..1655155
Genome map
AA seq 315 aa AA seqDB search
MMRVITDLQWRSMVLAHFPEGRPALFDLHSHTRASDGLLSPEALVVRAVERGVTTLAITD
HDTLGGISAARQAIADQSLPLELIAGVEISTLWEHHEIHVVGLNVDMNCPALGAFLTLQA
QRRDERAAEIGRRLARARIEGALEGAQRLAQGAQLTRGHFARYLVERGYATCSADVFKHF
LARGKTGYVPPQWGAIADTVAVIHQAGGVAVLAHPGRYRLSGKWLKRLLTAFCAVGGDAL
EVAQCQQPPHERHQLGLLARQFALSASQGSDFHQPTPYLDLGRGLSLPDGVLPVWMYWAS
VPQASQPGASLLEAL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggtcataaccgatttgcagtggagatccatggtgttagcgcattttccagag
ggacgcccggcgctgtttgatttacacagccatacccgggcgtctgatgggctattgagc
cctgaggcgctggtggtgcgggctgtggagcggggcgtcaccaccctggcgatcaccgat
cacgatacgttaggcggtatcagcgccgcccgtcaggcgatcgccgatcagtcgctgccc
ctggagctgatcgccggcgtagagatttctacgctgtgggagcatcatgaaattcacgtc
gtgggactgaatgtggacatgaactgcccggcgctgggcgcttttctgacgctgcaggcg
cagcggcgcgacgagcgcgccgcagaaatcggacgtcgcctggcgcgggcccggattgag
ggtgcgttggagggggcgcagcgcctggcgcagggcgcgcagctgacccgggggcatttt
gcccgctacctggtcgaacgtggctacgcgacctgcagcgcagacgtgtttaaacatttt
ctggcgcgcggtaagaccggttatgttcccccgcagtggggcgcgatagccgacaccgtg
gcggtgatccatcaggcgggtggcgtggcggtgctggcgcaccccgggcgctaccgtctg
agcggtaaatggctgaaacgcctgctgaccgcgttctgcgccgtcggcggtgacgcgctg
gaggttgcccaatgccaacagccgccccatgagcgtcaccagctggggctgctggcccgc
cagtttgcgctatcggcatcgcagggatctgactttcatcagcctacgccttatctggat
ttggggcggggcctttctttacccgatggggtgctccccgtctggatgtattgggcttcg
gtgccgcaggcttcccaacccggcgcgagtctactggaggctttatga

DBGET integrated database retrieval system