KEGG   Edwardsiella ictaluri: NT01EI_1821Help
Entry
NT01EI_1821       CDS       T00912                                 

Definition
(GenBank) exoribonuclease II, putative
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eic03016]
    NT01EI_1821
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     NT01EI_1821
Transfer RNA biogenesis [BR:eic03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    NT01EI_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2 PilZ
Motif
Other DBs
NCBI-ProteinID: ACR68998
UniProt: C5BFN5
Position
complement(1758102..1760045)
Genome map
AA seq 647 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRVEGVVKGTDKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
RAAVQVDKEREIAEPEELLEPFLTRFVGRIQKKENDERLSIIPDHPLLKDAIGCRPARGL
DRAFRQGDWVLAEMRRHPLKGDRSFFAEITAFITDGGDHFAPWWVTLARHDLACSAPQWQ
AGTLLEEGLDREDLCALPFVTIDSASTEDMDDALHVRENPDGSLRLTIAIADPTAYVSAD
SPLDAEACHRAFTTYLPGFNIPMLPRDLSDDLCSLREGQRRPVLACEVTLDADGGLRNDI
RFFSGWIESKAKLAYDRVSDWLEDCGDWQPPSDDIAAQIRLLHRVANARTQWRQQHALVF
RDRPDYRFVLDDHGNVTDIVAEPRRVANRIVEECMITANVCAALVLREGLGFGIYNVHTG
FDPALVEQAVSLLNANDVATNAEALLTLDGFCTLRRHLDSLPGTFLDSRIRRFQTFAEIS
TEPGPHFGLGLEAYATWTSPIRKYGDMVNHRLLKALIAGKPTTRPVQAMTQQLAERRRQN
RMAERDVGDWLYARFLKERVNAPIPFNAEIIDISRGGMRVRLLENGAVAFIPASFIHAVR
DEMVCSQENGTLQVKGRVVYRQGDTVPVTLSEVRLDTRSLIARPFSA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggacaacccgctgcttgcccagctaaaacagcaacttcactcgcagactccc
cgtgtggaaggcgtggtcaagggaaccgacaaaggctttggctttttagaggttgacgcg
cagaaaagctatttcattccaccgccgcaaatgaagaaagtgatgcacggtgaccgcatc
cgtgccgccgttcaggttgataaagagcgtgaaatcgccgagccggaagagctgttggag
ccattcctgacccgttttgtcggccgtattcagaaaaaagagaacgatgagcgcctgtcc
attatcccggaccatccgctgttgaaagacgccatcggctgtcgtccggcacgcggtctg
gatcgcgccttcaggcagggagactgggtgctggccgaaatgcgccgccacccactgaag
ggcgaccgcagcttctttgccgagatcaccgccttcatcaccgacggcggcgaccacttt
gccccttggtgggtcaccctggcccgtcacgatctggcgtgcagtgcaccgcagtggcag
gcgggaaccctgctggaggagggactggatcgcgaagatctgtgcgcgctgccgtttgtc
accatcgacagcgccagcaccgaagacatggatgatgcgctgcacgtgcgcgagaacccc
gacggcagcctgcgtctgaccattgccatcgccgatccgacggcctacgtcagcgccgac
agcccgctggacgccgaagcgtgtcatcgcgccttcaccacctatctcccgggctttaac
atcccgatgctgccgcgcgatctctccgacgacctgtgctcactgcgcgaagggcagcgc
cgtccggtgctggcctgcgaggtcaccctcgacgccgacggcggtctgcgcaacgacatc
cgcttcttcagcggctggatcgagtccaaagccaagctggcctacgatcgggtttccgac
tggctggaggactgcggcgactggcagccgccgagcgacgatatcgctgcccagatccgc
ctgctgcaccgcgtggccaacgcccgtacccagtggcgtcagcagcatgccctggtgttc
cgcgatcgcccggactaccgctttgtcctcgacgatcacggcaacgtcaccgatatcgtc
gcggagccgcgccgcgtggccaaccgcatcgtggaagagtgcatgatcactgccaacgtc
tgtgcggcgctggtgctgcgcgaaggcctcggattcgggatctacaacgtccataccggc
ttcgatccggcgctggtggaacaggccgtctcattactgaacgccaacgacgtcgccacc
aacgccgaagcgctgctgaccctggacggcttctgcaccctgcgccgccatctcgactcg
ctgccgggcaccttcctggatagccgtatccgccgcttccagacctttgccgaaatcagc
accgagccggggccgcactttggcctggggctggaggcctacgccacctggacttcaccg
atccgcaagtatggcgatatggtcaaccaccgtctgctgaaggcactgatcgccggtaag
ccgacgacgcggccggtccaggcaatgacgcagcagctggccgagcgccgccgccagaac
cggatggcggagcgcgacgtcggcgactggctgtacgcccgcttcctgaaggagagggtt
aacgccccgattccattcaacgccgagatcatcgatatctcacgcggtggcatgcgcgtc
cgcctgctggaaaatggcgcggtggcctttattccggcctcctttatccatgccgtgcgc
gacgagatggtatgcagtcaggagaacggcacccttcaggtgaaaggccgcgtcgtctac
cgccagggcgataccgttccggtgaccctgagcgaggttcgcctcgatacccgcagcctg
atcgcccgccccttcagcgcctga

DBGET integrated database retrieval system