KEGG   Edwardsiella ictaluri: NT01EI_2063
Entry
NT01EI_2063       CDS       T00912                                 

Definition
(GenBank) urease, gamma subunit, putative
  KO
K01430  urease subunit gamma [EC:3.5.1.5]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00220  Arginine biosynthesis
eic00230  Purine metabolism
eic01100  Metabolic pathways
eic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NT01EI_2063
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NT01EI_2063
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    NT01EI_2063
Enzymes [BR:eic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     NT01EI_2063
SSDB
Motif
Pfam: Urease_gamma
Other DBs
NCBI-ProteinID: ACR69239
UniProt: C5BDC2
Position
complement(1984632..1984934)
AA seq 100 aa
MQLTPREVEKLMVYTLADVALKRKQRGVKLNYPEAVSIITVTAMEGARDGKTVEEVMNEA
RSVLTRDDVMDGVVELIPNVQVEAIFTDGSRLVTVHDPIQ
NT seq 303 nt   +upstreamnt  +downstreamnt
atgcagttaactcctagagaagtggagaagttaatggtttacacgctggcggatgttgcg
ttaaaacgcaaacagcgtggtgtgaagctgaactatcctgaagctgtatcgattattaca
gtaacggccatggaaggtgccagagatggaaaaaccgtcgaggaagtgatgaatgaagcg
cgaagtgtattgacccgcgatgatgtcatggatggcgttgtggagctaattccgaacgta
caggtagaagccatctttacggatgggagtcgcttagttactgttcatgatcctatccaa
taa

DBGET integrated database retrieval system