KEGG   Edwardsiella ictaluri: NT01EI_2209Help
Entry
NT01EI_2209       CDS       T00912                                 

Definition
(GenBank) acetyl-CoA acetyltransferase family
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00071  Fatty acid degradation
eic00072  Synthesis and degradation of ketone bodies
eic00280  Valine, leucine and isoleucine degradation
eic00310  Lysine degradation
eic00380  Tryptophan metabolism
eic00620  Pyruvate metabolism
eic00630  Glyoxylate and dicarboxylate metabolism
eic00640  Propanoate metabolism
eic00650  Butanoate metabolism
eic00900  Terpenoid backbone biosynthesis
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
eic01212  Fatty acid metabolism
eic02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NT01EI_2209
   00630 Glyoxylate and dicarboxylate metabolism
    NT01EI_2209
   00640 Propanoate metabolism
    NT01EI_2209
   00650 Butanoate metabolism
    NT01EI_2209
  Lipid metabolism
   00071 Fatty acid degradation
    NT01EI_2209
   00072 Synthesis and degradation of ketone bodies
    NT01EI_2209
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NT01EI_2209
   00310 Lysine degradation
    NT01EI_2209
   00380 Tryptophan metabolism
    NT01EI_2209
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NT01EI_2209
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NT01EI_2209
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NT01EI_2209
Enzymes [BR:eic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NT01EI_2209
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01EI_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: ACR69383
UniProt: C5BFV6
Position
2128883..2130067
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALAATSAIDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLKSGLSEQVCGFTVNKVCGSGLKSVALAAQAIQAGQAQAVIAGGMENMSQ
APYLLNAQARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYDISREMQDALA
LLSQQKALAAIHAGAFRAEIVPVSVTSRKKTTLFERDEFPKADSTAEGLAALRPAFDKAG
SVTAGNASGINDGAAALVVMEENAARAAGLTPLARIKGYASGGVAPALMGMGPVPATQKA
LRQCGLQMADIDLIEANEAFAAQFLAVGKALGLDAEKVNVNGGAIALGHPIGASGARVLV
TLLHALSARDKSLGLATLCIGGGQGIALIVERIS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcagtgcgcaccgccatcggcagcttcaacggcgcc
ctggcggcaaccagcgccatcgatcttggcgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcaacgggtggatgaggtgatcatgggcaacgtactgcaggccggg
ctgggacaaaacccggcgcgtcaggcgctgttaaaaagtggcctcagcgaacaggtctgc
ggatttaccgtcaacaaggtctgcggctcgggcctcaaaagcgtggcgctggccgcccag
gccattcaggcgggccaggcgcaggcagtgatcgccggtggcatggaaaacatgagtcag
gcgccatatctgctgaatgcacaggcgcgctggggctaccgcctcggcgacgggacgctg
accgacgttatcctgcaggatggcctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatatgacatcagccgtgagatgcaggacgcactggcc
ctgctctcccagcaaaaggcgctggcggccatccatgccggtgccttccgggccgagatt
gtcccggtcagcgtgacgtcgcgtaaaaaaactaccctctttgagcgcgacgaattcccc
aaagccgactccacggcggaaggacttgccgccctgcgcccggcgttcgataaggcgggc
agcgtcaccgccggtaacgcctcagggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaaacgccgcccgggcggcgggactgacaccgctggcgcggattaagggctatgcc
agcggcggcgtcgcaccggcgctgatggggatggggccggtccccgccacccagaaggcg
ctgcgacagtgcgggctgcagatggccgatatcgatctgattgaggccaatgaagccttt
gccgcgcagttcctggccgtcggaaaggcgctggggctggatgccgaaaaggtgaacgtc
aacggcggcgccatcgcgctgggccaccccatcggcgccagcggcgcccgggttctggtc
accctgctgcacgcgctctccgcccgggataagagcctggggctggcgacactgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcagctga

DBGET integrated database retrieval system