KEGG   Edwardsiella ictaluri: NT01EI_2639Help
Entry
NT01EI_2639       CDS       T00912                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein C, putative
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00790  Folate biosynthesis
eic01100  Metabolic pathways
eic04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT01EI_2639
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    NT01EI_2639
Enzymes [BR:eic01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     NT01EI_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaC
Motif
Other DBs
NCBI-ProteinID: ACR69807
UniProt: C5B7H1
Position
complement(2532285..2532770)
Genome map
AA seq 161 aa AA seqDB search
MSQLTHINAAGEAHMVDVSAKAETVREARAEAYVTMRQDTLAMIIDGKHPKGDVFATARI
AGIQAAKSTWQLIPLCHPLLLSKVEVTLSVEPVHSRVRIETCCRLCGKTGVEMEALSAAS
VAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFHAGEVQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttaacccatattaatgcggccggtgaggcgcacatggttgacgtttccgcc
aaggcggagacggtacgtgaagcgcgcgccgaggcctatgtcaccatgcgtcaggatacc
ctggcgatgatcatcgacggtaaacaccctaagggggacgtatttgccaccgcccgtatt
gccggtatccaggccgccaagagcacctggcagctaatcccgctatgtcacccgctgttg
ctgagcaaggtcgaggtgacgctgagcgtcgagccggtccacagtcgggtacggatcgaa
acctgctgccgtctgtgcggtaagaccggggtggagatggaggcgctgagcgccgcctcg
gtggccgcgttgaccatctatgacatgtgcaaagcggtgcagaaagacatggtgatcggg
ccggtgcgtctgctggccaaaagcggcggcaagtccggggattttcacgcgggggaggta
caatga

DBGET integrated database retrieval system