KEGG   Edwardsiella ictaluri: NT01EI_2742
Entry
NT01EI_2742       CDS       T00912                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eic02044]
    NT01EI_2742
Secretion system [BR:eic02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NT01EI_2742
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACR69910
UniProt: C5B8Q0
Position
2636129..2637970
AA seq 613 aa
MAELLPYYNRELAFLRQLGREFASQYPKVAGRLLLEEGVSEDPHVERLIEAVAFLCARVH
HKIDEQFPEITNALLGILYPHYLRPIPSISLVQFSVDPAQTNLSGPLRLPRHTSLLSRQV
DGMACRFRTTYPVEIWPVSVIHACFSPARQTSLSVQQQGSAGLICIQLQAHPGHHLNTLG
MDRLRFFLQGEPAVVHTLYELLFNNVTKVVLRSGAEEWTLPASIISPVGFDEDENLFDYD
ARSSQAYRLLHEYFVFPDKFLFFDMTGLLQATPLPEACQEIDLLIHLSEFEREGRLTKLT
DTIDASTFRLGCSPVVNLFRQRAEPLQITHRKTEYQIIPDIRRPWGMEVYSVDAVSKQVK
NDGQEKTKLYRPLFGLHHANDSEPQRVFWMENRRGGIRGDDPGKDVYLSLVDLDFDPNQS
SSETLSIDVTCTNREFPSLLPFGGDQGDFEVDGGSLVTRIHCLRKPTSTLRPAHGRAAMW
RLISHLNLNLLSITGENEEATEAFRELLGLYNFSDSPALRQQIAGIVSINSQPATARLCS
RNQAAVVRGIEITLVLDESQFEGAGVYLFSAVVERFVSQYSAINSFTRLHVRTQQREQAL
KRWPPRAGKAVLS
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggccgagttattgccctactataaccgggaactggcgttcctccgccagttgggacgt
gagttcgcctcccagtatcccaaggtagccggccgccttctgctggaggagggagtatcg
gaagatcctcatgtcgagcggctgatcgaagccgtggcatttctctgcgcccgcgtgcat
cacaagatagatgagcagttccccgaaataaccaatgcgttgctggggatcctctatccc
cattacctgcgcccgattccctccatatctctggtccagttttcggtcgatccggcacag
accaacttgtcaggcccgctgcggctgccacgacataccagcctgctatcccgccaggtg
gatggcatggcatgccggttccggaccacctacccggtggaaatttggccggtgtcagtc
atccatgcctgcttctcccccgcgcgacaaaccagcctgtcagtacaacagcagggaagc
gccggtctgatctgtattcagctgcaagcccatccgggacatcatctgaataccctggga
atggatagactgcgtttctttcttcagggtgagcctgccgtggtgcacaccctgtatgag
ctgctgttcaacaatgtgaccaaggtggtcctgcgctccggggcggaggagtggaccctg
cctgccagcatcatctcaccggttggattcgacgaggatgagaacctgtttgactacgat
gcccgctcgtcccaggcctaccgcctactgcacgaatactttgtttttcctgacaagttc
ctgttttttgatatgaccgggttgctgcaggcaactccgctgcctgaggcctgccaggag
atcgatctgttgatccatctgtcagagttcgaacgggagggacgcctgaccaaactgacc
gatactatcgatgcctcaacgttccggctgggatgcagcccggtggtcaacctgttccgg
cagcgggcagagcctttgcagataacccaccgtaaaaccgagtaccaaattattcccgat
atacgccgtccctggggcatggaggtctattcggtcgatgccgtcagtaaacaggtcaag
aatgatgggcaagagaagacgaagctctaccgtcccctgttcggcctgcatcacgccaac
gacagtgagccacagcgggtattctggatggaaaatcgccgtggcgggatccgcggggat
gacccgggcaaggacgtctatttatccctggtggatttggattttgaccccaatcagtca
tcatcggaaaccctgagcatcgatgtgacctgcactaaccgagaatttccctccctgctg
cccttcggcggtgaccaaggggacttcgaggtagacggaggctctctcgtcacccggatc
cactgcctgcgcaagccgacatcgaccctgcgccctgcccacggcagggcagccatgtgg
cggctgatctcccacctgaacctgaacctgctctccatcaccggtgaaaacgaggaggca
accgaggcattcagggagctgctcggactgtataacttcagcgactcccccgccctgcgt
cagcagattgccggcattgtcagtatcaacagccagccggcgacggcgcgcctgtgcagc
cggaatcaggcggcggtggttcggggcatcgaaattacactggtgctggatgagagccaa
tttgagggagccggggtgtatctgttcagtgccgtggtagagcgattcgtcagccagtat
agcgccatcaacagttttacccgcctgcatgtacgcacccagcagcgggaacaagcgctc
aagcgctggccgccgcgggcgggtaaggcggtgctgtcatga

DBGET integrated database retrieval system