KEGG   Edwardsiella ictaluri: NT01EI_2871Help
Entry
NT01EI_2871       CDS       T00912                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eic  Edwardsiella ictaluri
Pathway
eic00020  Citrate cycle (TCA cycle)
eic00190  Oxidative phosphorylation
eic00650  Butanoate metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
Module
eic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eic_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT01EI_2871
   00650 Butanoate metabolism
    NT01EI_2871
  Energy metabolism
   00190 Oxidative phosphorylation
    NT01EI_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACR70032
UniProt: C5BG69
Position
complement(2762163..2762510)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIVITLYVIYLLAFVVGAGPLNYTLWLDFFSSRITQVF
TLLTLLCILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVVLVVYLIYGTLVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcatcggcgctggggcgcaacggtattcaggattggctgctgctgcgt
gcatccgccatcgtcatcacgctgtacgttatctatctgctggcttttgtggtcggcgca
ggcccactcaactatacattgtggcttgacttcttctcttcgcggatcacccaggtgttt
accctgctgaccttgctgtgcatcctgatccatgcctggatagggatgtggcaggtattg
accgactatgtcaagccgctggcgttgcgcctggtgctacagctggcgatcgtggtggtc
ctggtggtctatctgatttatggaacattggttgtgtgggggatatag

DBGET integrated database retrieval system