KEGG   Edwardsiella ictaluri: NT01EI_3008Help
Entry
NT01EI_3008       CDS       T00912                                 

Definition
(GenBank) UDP-2,3-diacylglucosamine hydrolase, putative
  KO
K03269  UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00540  Lipopolysaccharide biosynthesis
eic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NT01EI_3008
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eic01005]
    NT01EI_3008
Enzymes [BR:eic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.54  UDP-2,3-diacylglucosamine diphosphatase
     NT01EI_3008
Lipopolysaccharide biosynthesis proteins [BR:eic01005]
 Lipid A
  NT01EI_3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ACR70161
UniProt: C5B8V8
Position
2895015..2895794
Genome map
AA seq 259 aa AA seqDB search
MATLFIADLHLSQQEPAITAGFLRFLAEEAPKAEALYILGDFFDYWIGDDDPQPLHRQVA
GALRQLSDNGVPCYFICGNRDFLLGKSYAKRCGMTLLPDEQIITLYGQPILLLHGDTLCS
DDRDYQRYRRRVHNPLLQWLFRRLPLRLRLKIAVGMRQQSQRSNSAKAMTIMDVNQETVC
ATLRRHGVQRMIHGHTHRPALHHFSLDDGRCALRAVLGAWHTHGSMIRVDAQGIHLIELP
AHPAEDEIITTRLRSANLV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctgttcatcgctgatttacacctcagccaacaggaaccggcgatcaccgcc
ggttttctgcgttttcttgccgaagaggcccccaaggcagaagccctgtacattctgggc
gactttttcgactactggataggtgatgatgacccccagccactgcaccggcaagtcgcc
ggggcgctgcgccagctgagcgacaacggcgttccctgttacttcatctgcggcaaccgc
gattttttactgggtaagtcctatgccaagcgctgcggcatgaccctgctgcccgacgaa
cagatcattacgctgtacggtcagcctattctgctgctgcacggcgataccctgtgtagc
gacgatcgcgactaccagcgctaccgacgccgggttcacaaccccctgctacaatggctg
ttccgccgccttcccctgcgcctgcgcctgaagatcgccgtcggcatgcgccaacagagc
cagcgcagcaacagcgccaaggcgatgaccatcatggacgtcaaccaggagacggtctgc
gccaccctgcggcgccacggcgttcagcgcatgatccacggccatacccaccgcccggcc
ctgcaccacttcagtctcgacgatggccgttgcgccctgcgtgcggtactgggtgcctgg
catacccacggttcgatgatccgggtcgatgcacaggggatacatctgatcgagctgcct
gctcaccccgccgaggacgagatcatcacgacgcgattgcgctccgccaacctggtctga

DBGET integrated database retrieval system