KEGG   Edwardsiella ictaluri: NT01EI_3674Help
Entry
NT01EI_3674       CDS       T00912                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme, putative
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00500  Starch and sucrose metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT01EI_3674
Enzymes [BR:eic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NT01EI_3674
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01EI_3674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACR70802
UniProt: C5B962
Position
3563578..3565788
Genome map
AA seq 736 aa AA seqDB search
MSVLPSTHKIQQLLAGQCADPFALLGMHTTAKGLAVRALMPEAESVQVVDRKNGRTLVTL
ERIHEGGFFCGLVPRRKNPFPYLLRVTWDNHQQLLEDPYRFGPLLGEIDNWLLKEGTHLR
PYERLGAHLTQLADIRGVSFAVWAPNAQRVSVVGNFNAWDGRRHPMRLRRESGIWELFIP
GIEAGELYKFELIDARGERVLKADPYAFEAQMRPDTASLVAPLPEKSAISAQRSAANGFS
APISIYEVHLGSWRRHSDNGYWLSYREMAEQLIPYVKEMGFTHIELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPQEFREFIDAAHAAGINVLLDWVPGHFPSDEWGLANFDGTALYEYA
DPREGFHQDWNTLIYNYGRYEVRNFLAGNALFWQERYGIDGLRVDAVASMVYRDYSRAAG
EWVPNCHGGNQNLEAIEFLRYTNRTLGEQHPGSVCMAEESTDFSGVTLPPDDGGLGFHFK
WNMGWMHDTLNYMKHDPVYRKYHHNLMTFGLLYAWSENFVLALSHDEVVHGKGSLLDKMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGGEFAQGREWNNESSLDWHLLEGEDNWHHGVQ
RLVRDLNLCYRSCGALHRWDCDARGFRWRVVDDDQNSVFAFVRRDDMGNEVLVVSNFTPV
PRHHYRIGVDLPGRYREILNTDSSHYHGSNSGNQGGVLSEAVGSHGCEYSIQLTLPPLST
LYLCLDNGDGDDAQAG
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacttcccagcactcacaagatccaacaactgctcgccggccagtgcgccgat
cccttcgctttgctggggatgcatacgacagccaaagggctggccgtgcgggcgctgatg
cccgaggcagaatcggtacaggtggtcgaccgtaaaaacgggcgcacgctggtcacgctg
gagcgcatccatgagggcggtttcttctgcggtctggtaccgcggcgtaagaatcccttc
ccttatctgctgcgcgtcacctgggataatcatcagcagctgctggaagatccctaccgt
ttcgggccattgttaggtgaaatcgataactggctgctcaaagaggggacccatctgcgt
ccctatgaacgattgggcgcccacctgacccaactggccgatatccgcggcgtcagtttc
gccgtctgggcacccaacgcccagcgcgtctccgtagtcggcaactttaatgcctgggac
ggacgccgccacccgatgcgcctgcgccgggaaagcggtatctgggagctgttcatcccc
ggcatagaggccggggagctgtacaagtttgagctgatcgacgcccgcggcgagcgggta
ctgaaagctgacccctatgcctttgaggcccagatgcggccggataccgcctcgctggtc
gctccgctgccggagaaaagcgccatcagcgcccaacgcagtgccgccaatggcttcagt
gctccgatctccatctatgaggtacacctcggctcctggcgtcgccacagcgacaatggc
tactggctgagctaccgggagatggccgagcagctcatcccctacgtcaaagagatgggg
tttacccatattgagctgctgccgatcaatgaacatcccttcgacggctcctggggctat
cagccgctggggttatacgccccgacccggcgctacggtactccgcaggagttccgcgaa
tttatcgatgccgcccacgccgccgggatcaatgtcctgctcgactgggttcccggccac
tttcccagcgacgagtgggggctggctaacttcgacggtacggcgctgtatgaatacgcc
gatccgcgcgaaggcttccatcaagactggaataccctgatctacaactatggccgctat
gaagtacgtaacttcctggcgggcaacgccctattctggcaggagcgctatggcatcgac
ggcctgcgcgtcgacgccgtggcctcgatggtctaccgcgactacagccgcgccgcgggc
gaatgggttcccaactgccacggcggaaaccagaatttggaggccatcgagttcctgcgc
tataccaacagaactctgggagagcaacaccccggcagcgtctgtatggctgaagagtcc
actgacttttccggcgtcaccctgccaccggacgatggcggcctgggcttccacttcaag
tggaatatgggctggatgcacgacaccctcaactacatgaagcacgatccggtctatcgt
aaatatcaccacaatctgatgaccttcggcctgctgtatgcctggagcgaaaattttgtg
ttggccctctctcacgacgaagtcgtgcacggcaagggctcgctgttggataaaatgccc
ggtgatgcctggcagaaattcgccaacctgcgcgcctactacggctttatgtgggcacat
cccggcaaaaaactgctgtttatgggcggggagtttgcccaggggcgcgaatggaacaac
gagtccagcctggactggcacctgctggagggcgaagacaactggcaccacggcgtacag
cggctggtacgggatctgaacctctgttatcgcagctgcggtgccctgcaccgttgggat
tgcgacgcgcgcggctttcgctggcgggtggtcgatgacgatcagaactcagtcttcgcc
tttgtccgccgcgatgatatgggcaacgaggtgctggtggtcagtaactttacgccggtc
ccccgtcaccattaccgtatcggcgtcgatctgccggggcgctaccgcgaaattctcaat
actgactccagccactaccacggcagcaacagcggcaatcagggcggcgtgctcagcgag
gcggtgggcagccacggctgtgagtactccatccaactgaccctgccgccgctgtcaacg
ctctatctgtgtctggacaatggggacggagacgatgctcaggccgggtaa

DBGET integrated database retrieval system