KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0221
Entry
ECOK1_0221        CDS       T01997                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06887  uncharacterized protein
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eih00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECOK1_0221
SSDB
Motif
Pfam: T6SS_HCP PilN_bio_d
Other DBs
NCBI-ProteinID: ADE89306
Position
complement(243345..243824)
AA seq 159 aa
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELT
ITKPVDKSSPLLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHT
INDSPGQAEESVSFTYESINWEHSVAGTSAYSLWSERIF
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcaaatcccgtctatctgacactgaacggagaacttcaggggctgatttcatccgga
tgctcgtcaatgccgtccatcggtaacaaagcccagattgcacatcaggatcagatcatg
gtgacgtcactgtcccatggtctgagccgtgcgcagaatgtcaaccatcaggagttgacc
atcacgaaaccggtggacaaatcctcccctctgctgggcaaggccatttcagagaatgaa
tgtctgacctgtgattttgtattctaccgcaccaaccgctttggaattaatgaaccgtac
tacaagctgaaactggctaacgcccggctctcaaacatcggccttaccgttccccatacc
attaacgacagtccagggcaggcggaagagtctgtgtcatttacctatgagagcatcaat
tgggagcacagcgtcgccggaaccagtgcatacagcctttggagtgaacggattttctaa

DBGET integrated database retrieval system