KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0222Help
Entry
ECOK1_0222        CDS       T01997                                 

Definition
(GenBank) ImpA domain protein
  KO
K11911  type VI secretion system protein VasL
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eih00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eih02044]
    ECOK1_0222
Secretion system [BR:eih02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECOK1_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N
Motif
Other DBs
NCBI-ProteinID: ADE89860
Position
complement(243842..245200)
Genome map
AA seq 452 aa AA seqDB search
MSNYALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDL
HTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNIL
RQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNR
TDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQGDTVKGFV
AGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPP
LQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFAD
LMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattacgcactgacacaaactatcgttaccggcagcgatccgcgcgccctgccg
gagttcagcgccatccgcgaagaaattaacaaagctaaccacccgtcacagccggagctg
aactggaaactggtggaatcgctggcgctgtcgatttttaaggccaacggggtggatttg
cataccgccacctactatacgctggcacgtacacgtaatcagggactggcagggttctgt
gaaggcgcggaactgctggctgcgatgatcatccacgaatgggataaattctggccgcag
agtggtccggcgcggactgagatgctggactggttcaacacccgcaccgggaatatcctg
cgccagcaggtttccttttccgaaaatgatctttcgttgctctaccgcacggaacgggct
ttgcagcttatctgcgacaaactccagcaagtggaactgaagcgccagccgcgcgtggaa
aatctgctttattttgtgcagaacacacgcaagcggtttgagccgcagcccagaaaccgt
actgatacggcggcacagaccatggtcagaacgctggtctatgcgcctgaaggcacggct
tccgccacagcggaaaccatgccccccctacccgacctgccggaaatgcgggtgggggtg
cgcggtgtggcagataacgccgacaaagcaaaacagggcgacacggtaaaaggttttgtt
gccggtgccgcctgtactgccgttatcgcatctgcactctggtggtggcaggcgtatccg
atgcagcagcagcttacacaggtcagggataccacacagggagccgccaccgtctggttg
gcatccccggtactgaaagaatatgaacagtacctgcaacagcttctgaatgccccgcca
ctacagccgctggaaaccggaatgcagatgatgcgcaccgcagacaccctctggccggaa
agcctgcaacagcaggaagccagcaggatgtggagcaacacgctgagaaaccgggcgcaa
gccagtccgcagatgaagggctggcaacaagcgcggcagaatttgcgggattttgcagat
ttgatgatgaagaaggagacggagaaacagggtttcaccctatcgtatatcaaaacggtg
acctggcaggccgaacggttactgaatcaagaaacaccactggagtacctgctgacgcag
taccaggagacccgtacacagaagcaggacacacaggcgttggaaaaagagatcaacgaa
cggctggacgggctgttaagccgctggctgctgctgaaaaataccggacaggatatggca
acggataacagaaccgaacctgtccatccaactcattga

DBGET integrated database retrieval system