KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0226
Entry
ECOK1_0226        CDS       T01997                                 

Gene name
clpB
Definition
(GenBank) ATP-dependent chaperone protein ClpB
  KO
K11907  type VI secretion system protein VasG
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eih00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECOK1_0226 (clpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eih02044]
    ECOK1_0226 (clpB)
Secretion system [BR:eih02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECOK1_0226 (clpB)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_7 NACHT RsgA_GTPase Clp_N AAA_18 AAA_24 Sigma54_activat Rad17 AAA_6 ABC_tran_CTD
Other DBs
NCBI-ProteinID: ADE89010
Position
complement(250945..253704)
AA seq 919 aa
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHVLLQMLAIPRNDVRVIAERT
GISAEDLRQALTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLT
LLHSPLRYIPPAAARLLTAINRDQLQQDFAAWTKESAESVDLAGGQTPRATETGDTLLAR
YAKNMTADARNGRLDPVLCRNYEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLALRI
VAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVIFSPVPVILFIDEAHTL
IGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEPNA
AEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARVAI
NLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLEQYDETLSALDELEV
AWQQQTLVQEIIALRQQLLGVAEDDVASLPDADAVEDTPPEAEQDSTDAESADDAGSVQP
EETAETVSPVQRLAQLTAELDALHNDQLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMS
VITDLPVWLGGTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQ
LAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLD
EVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQE
ALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIGPEV
TDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADV
EDALPDDAVTPQTEDETVL
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgatccagattgatttagccacgctcgtaaagcggcttaacccctttgcaaaacaggcg
ctggaaatggctgcctcggagtgtatgagccagcaggccagtgagatcaccgttgcccat
gtgctgttacagatgctggcaatcccgcgcaacgacgtaagggtgattgccgaacgcaca
ggcatcagtgcggaggatttacgccaggcgctgaccgtggagagttatcccggtggacgt
tccgccgaaggctatcccagcttctccccgatgctgatcgaatggctcaaggagtcatgg
ctgctggcctcagcccagatgcagcacagcgaactgcgcagcggcgtcctgctgcttact
ctgctgcattcaccgctgcgctatattccacccgctgctgcccgtctgctgacggccata
aaccgcgaccagttacagcaggatttcgcagcatggacaaaagaatccgccgaatccgtg
gatctggctggcgggcaaacgccccgcgcaacggaaaccggcgacaccctgcttgcccgc
tacgccaaaaacatgaccgcagacgcccgtaacggcaggcttgacccggtactgtgccgc
aactatgaaatcgacctgatgatcgacattctctgccgccgccgtaaaaacaatccggtg
gtagtgggcgaagcaggcgtgggtaaaagcgcgctgattgaagggctggcgctgcgcatc
gtggcaggccaggtgccggacaagctgaaaaacaccgatatcatgacccttgacctgggc
gcattgcaggccggtgcgtcggtgaaaggtgagtttgaaaaacgcttcaaggggctgatg
gcggaggtcattttctccccggtgccggtcattctgtttatcgacgaagcacataccctg
attggcgcgggcaaccagcagggcgggctggatatatccaacctgctcaaaccagcgctg
gcgcgcggcgagctgaaaaccatcgccgccaccacctggagcgagtacaaaaaatatttc
gagaaagatgcagctttgtcgcgccgcttccagttagtgaaggtcagcgaacccaacgct
gccgaagccaccattattctgcgcggtttgtcggcggtctatgaacaatctcacggcgtg
ctgattgatgatgacgccttgcaggccgctgcgacactgagcgagcgttatctctccggg
cgtcagttgccggacaaagccattgatgtgctggacaccgcctgcgcccgtgtggccatc
aacctgtcatcgccgccaaaacaaatctcggcactgaccaccctgagccaccagcaggag
gcagaaattcgccagcttgagcgcgagcttcgcatcgggctgcgtaccgacacctcacga
atgactgaggtgttggagcagtatgatgaaacgctgtcggcgctggacgaactggaagtc
gcctggcagcagcagacgctggtacaggaaattatcgcgctgcgccagcagttactgggc
gtggcagaagacgacgttgcgtcgttgccggacgcagatgccgtggaggatacgccgcca
gaggcagaacaggatagtaccgatgccgaatcggctgatgatgcaggcagcgtacagccg
gaagagaccgctgaaacagtttccccggtacaacggctggcacaactcactgccgaactg
gacgccctgcataacgaccagttgctggtttccccgcatgtcgataaaaaacagattgca
gcggtgattgctgaatggaccggcgtgccgcttaaccgcctgtcacagaatgagatgtcg
gtcatcaccgacctgccggtatggctcggcggcaccatcaagggccaggacctggcgatt
gccagcctgcataaacacctgctgaccgcacgcgccgacctgcgccgtccgggacgcccg
cttggtgcgttcctgctggctggccccagcggcgtgggtaaaaccgaaaccgtcctgcaa
ctggcggaactgctctatggcggacgtcaatacctgaccaccatcaatatgtctgagttc
caggagaaacacaccgtttcgcggctgattggctctcctccgggttatgtcggctacggt
gaaggcggcgtactgaccgaagcgattcgccagaaaccgtactcggtggtgctgctcgat
gaagtagaaaaagcgcacccggatgtactcaacctgttctaccaggcgtttgacaagggc
gagatggcagacggtgaaggccgcctgattgactgtaaaaatatcgttttcttcctgacc
tccaaccttggctaccaggtgattgtcgaacacgccgatgacccggaaaccatgcaggaa
gccctctatccggtgctggcggacttctttaaacctgctctgctggcgcgcatggaagtg
gtgccttacctaccgctgtcgaaagagacgctcgctaccattattgccgggaaactggcc
cgcctggataacgtgctgcgcagccgctttggcgcggacgtgattattgggccggaagtg
acggacgaaatcatgagccgcgtcacccgcgcggaaaacggcgcgaggatgctggaatcg
gttatcgacggcgacatgctgccgccgctctcgctgctgctgttgcagaaaatggcggcc
aacacggcgattgcccggattcgcctgtcggcggcagacggtgcgttcacggcagatgtg
gaagatgcgctgcctgatgatgccgtgacaccgcaaacagaggacgaaacggttttatga

DBGET integrated database retrieval system