KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0231
Entry
ECOK1_0231        CDS       T01997                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eih00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eih02044]
    ECOK1_0231
Secretion system [BR:eih02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECOK1_0231
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADE92625
Position
complement(257650..258699)
AA seq 349 aa
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRHGAPGQDISLRTEPAREIVRFSS
DASISFPGTDLSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEF
LDLFSHRWTQFAYHAWRKYRYYICFRSGGTDTFSQRMYALVGLGNQSVRDRLAINHSKML
AYAGILATPGRAPEVICNLVSHCFDLPDVTIERWQLRKVAIDPAHQNRLGVRNPKGKTAG
HIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSFLPDGENHLPLTMFLSFILRD
QFAWDLRLCLAPQQAKGMRLSDPASSRLGRTSFIGQPKVPPAITIRIRE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcaggagaaaatgggccagcacgccctgatatagcgacaaaaccgccgttaccggcg
gatgtgcgcaactgcaatttctatgtgctgatggaggcgctgtaccgtcggcatggcgcg
ccgggccaggacatttccctgcgtaccgagcctgcccgggagatcgtgcgtttcagctct
gacgccagtatcagttttccgggtacggacctgagtgcgctttcccgtagccagaacgga
cagtatgtactgcaaacccggttcctgggtttttccggcagccagtcgccgctaccgggc
tattatctggatcagatggcgcaggagtccgcacagaacgaagacggcctgaaagaattt
ctcgatctattcagccaccgctggacacagtttgcctatcatgcctggcgcaaataccgc
tactacatctgctttcgtagcggcggtactgacaccttttcacagcgcatgtacgcactg
gtcgggctgggtaatcagagcgtgcgtgacaggcttgccattaaccacagcaaaatgctg
gcctacgccggaattctggcaacaccaggccgcgcgccggaggttatctgtaatctggtg
tcgcactgttttgatttgccggatgtcaccattgaacgctggcaactgcgtaaagtcgcc
attgatccggcacaccagaaccggctgggtgtacgtaatccgaaaggaaaaacggctgga
catattccgggacgctccatactcggcgttaattttaccctcggcgcacgggtgccggat
cgcagcggaaaattcctgttgcagattggcggcctgtcgcgggagcgttatctctcattt
ttacccgatggcgaaaatcacctgccgctgaccatgttcctttcctttattctgcgcgac
cagtttgcctgggatttacggctgtgcctggcgccacagcaggctaaagggatgcgcctt
agcgatccggccagctcccgcctcggcagaaccagctttattggtcagccgaaagtaccg
cccgccatcacaatccgaatcagggaataa

DBGET integrated database retrieval system