KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0236
Entry
ECOK1_0236        CDS       T01997                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eih00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECOK1_0236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eih02044]
    ECOK1_0236
Secretion system [BR:eih02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECOK1_0236
SSDB
Motif
Pfam: T6SS_HCP DCAF15_WD40 SBBP
Other DBs
NCBI-ProteinID: ADE90556
Position
263656..264174
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPS
GQRAHKPFIFTVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATI
VDMNLHMPHCQDPAQREFTQLLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaaccccatgttacatttcaattacaggtcagacccaggggaacatcactgccggt
gctttcaccgcagattctgtcggcaatatctacgtgcagggacacgaagatgaaatgctg
gtgcaggagtttctgcataacgttactgttccaaccgatccgcagtctggtcagccttcc
gggcagcgtgctcacaaaccgttcattttcaccgtggcgctgaacaaagccgttccgctg
ctgtacaacgcgctggcctccggtgaaatgctgccgaaagtggagctgcactggtggcgt
acctctgttgaaggcaagcaggagcactacttcaccacacgtcttactgacgcgacgatt
gtggacatgaacctgcatatgccgcactgccaggaccctgcacagcgtgagtttacgcaa
ttgctcgcagtatcactggcctaccgtaaggttgagtgggagcacatcaaatccggtact
tctggtgccgatgactggcgtgcaccgctggaagcataa

DBGET integrated database retrieval system