KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0239
Entry
ECOK1_0239        CDS       T01997                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
SSDB
Motif
Pfam: DUF4150 Peptidase_C39 Peptidase_C70 PAAR_motif
Other DBs
NCBI-ProteinID: ADE92596
Position
267523..268962
AA seq 479 aa
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGS
VIAGTQSNAGKGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYT
KIKSPMISVIDRTFNYERTAEVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQS
WGEFFSIKNIRESLRNGIEGDKSQIREWFGENTLTQMGNGAITTLHGVADLALVTFDALL
DTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLINGQAWDALKKMIMDTNNGDQI
ALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLDSNVIKQLTLT
GCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVSESSLYALSNT
GSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgggtaactatcatatcggggatggtgaatgtagatttagagtcgtgtgttcttcacca
gatgtatgtgaagtaggaggttacaaggttccttttgacagttaccagactttagatagt
gaaagacagtacagttcaacggtatgggcgcgtggatgcagagctttaaatgttggttca
gtgattgctggaactcaaagtaatgccggtaaaggtgtcatatccggtacatctcaagga
acgggtgactgtgttattttaacgggaagtccgactgtaacaatagaagggaaacctgtt
gcttatcatggttcagttgttgggattaataaccacaactgccttggtaaattgtatacc
aaaataaaatcaccaatgatttctgtcattgatagaacttttaattatgaaaggactgct
gaagtaatacacgatttactgcttctgaaggatctcctctctgttggtaatatttttgac
ggagatatttcacctgaggttaaaaatgatttatttcaaataaaagatcctgaccaatca
tggggggagtttttttcaataaagaatatcagagaatctctcaggaatggtattgaagga
gataaatctcagatcagagaatggtttggagagaacacacttactcaaatggggaatgga
gcaatcaccactttacatggtgtggcggatttagccttagttacattcgatgctctgtta
gatacggcaacggcaacggttgcttgcccgataggcgaagatgggttatgtgaacaggca
aatataaatttaaatgaaaaagaacaggctttatttaatattagtaattcattgataaat
gggcaagcatgggatgcacttaaaaaaatgataatggatacaaataatggtgatcagatt
gctctggagcattttgccagctttttatggggctttatgatacccgcaaaaataccagaa
gaaaatatctctgggaaagtatttgtagagccagtagttttagaaggtggtgctggtggc
aattggacagtatttgatgaggttttagattcaaatgtaataaagcaattgactttaaca
ggctgtggagcggcctgtggggaaatgttgcttagggataggtatatttttgtcacgcaa
aatgtaattggaacagaattaacatctatgacgtcgctggcaaacaagcttaataaattt
gatgtcggctgggaagggaatgcagtgagcgaatctagtttatatgccctcagtaatact
ggttcatggggagcaatgatgtgggattctggaagtaaagtagggcattgggtacttgtt
aagggtgttgatgatgctgggaatgtgataatatatgatccatatcaagggagtcgatat
ctgatgactgaacaggaatttaaggaggtatggaatgggcatagtgtttacaaaccataa

DBGET integrated database retrieval system