KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_0253
Entry
ECOK1_0253        CDS       T01997                                 

Definition
(GenBank) putative chemotaxis protein
  KO
K02557  chemotaxis protein MotB
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih02030  Bacterial chemotaxis
eih02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eih00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ECOK1_0253
   02040 Flagellar assembly
    ECOK1_0253
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eih02000]
    ECOK1_0253
   02035 Bacterial motility proteins [BR:eih02035]
    ECOK1_0253
Transporters [BR:eih02000]
 Other transporters
  Pores ion channels [TC:1]
   ECOK1_0253
Bacterial motility proteins [BR:eih02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    ECOK1_0253
SSDB
Motif
Pfam: OmpA SulA
Other DBs
NCBI-ProteinID: ADE90170
Position
281972..282742
AA seq 256 aa
MIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHLPKPATVAVPEETEKKARDVN
EKTALLKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGS
AKIMPFFKTLLVELAPVLDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEE
AGMPENKVMQVSAMADQMLLDAKNPQSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQP
LVQKLDKQQVLSQRAR
NT seq 771 nt   +upstreamnt  +downstreamnt
ttgattgtcaacagcgtcagtaaatccgagcgtgaaagcattatcgccgcgctgcacggg
cagtcgatttttaacggtggtgggttgtcgccgttaaataaaatcagcccgtctcatctg
ccaaaacctgccaccgtggcggtgccggaagagacggagaaaaaagcgcgcgacgtcaac
gagaaaacggcgctgttgaagaagaaatccgccaccgagcttggcgagctggcgaccagt
atcaataccatcgcccgtgatgcgcatatggaagcgaatctggagatggagattgttccc
cagggattacgcgtgctgattaaagacgaccagaaccgcaatatgtttgaacgcggcagc
gcgaagattatgccgttctttaaaactttgctggtggagcttgcgccagtgttagactcg
ctcgataacaaaattattattaccgggcataccgatgcgatggcctacaaaaacaatatc
tacaacaactggaacctttcgggcgatcgcgcgctttcggctcgtcgggtgctggaagag
gccggaatgccggaaaataaagtgatgcaggtaagcgcaatggcggaccagatgctgctg
gatgccaaaaatccgcaaagcgcgggcaaccggcgcattgagattatggtgctgaccaaa
agtgcgtccgatacgctgtatcaatactttggtcagcatggggataaagtggtgcagccg
ctggtgcaaaagctggataagcagcaggtgctttcgcagcgagcgcgttaa

DBGET integrated database retrieval system