KEGG   Escherichia coli IHE3034: ECOK1_0755Help
Entry
ECOK1_0755        CDS       T01997                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eih  Escherichia coli IHE3034
Pathway
eih00010  Glycolysis / Gluconeogenesis
eih00260  Glycine, serine and threonine metabolism
eih00680  Methane metabolism
eih01100  Metabolic pathways
eih01110  Biosynthesis of secondary metabolites
eih01120  Microbial metabolism in diverse environments
eih01130  Biosynthesis of antibiotics
eih01200  Carbon metabolism
eih01230  Biosynthesis of amino acids
Module
eih_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eih_M00002  Glycolysis, core module involving three-carbon compounds
eih_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECOK1_0755 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECOK1_0755 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECOK1_0755 (gpmA)
Enzymes [BR:eih01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECOK1_0755 (gpmA)
Membrane trafficking [BR:eih04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECOK1_0755 (gpmA)
Exosome [BR:eih04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECOK1_0755 (gpmA)
  Exosomal proteins of melanoma cells
   ECOK1_0755 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADE92542
Structure
PDB: 

Position
complement(786706..787458)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctattcataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system