KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_2363Help
Entry
ECOK1_2363        CDS       T01997                                 

Gene name
bglX
Definition
(GenBank) beta-glucosidase, periplasmic
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih00460  Cyanoamino acid metabolism
eih00500  Starch and sucrose metabolism
eih01100  Metabolic pathways
eih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECOK1_2363 (bglX)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ECOK1_2363 (bglX)
Enzymes [BR:eih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ECOK1_2363 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like CARDB PHP DUF4842
Motif
Other DBs
NCBI-ProteinID: ADE92923
Position
complement(2439063..2441360)
Genome map
AA seq 765 aa AA seqDB search
MKWLCSVGIAVSLALQPALADDLFGNHPLTPEARDAFVTELLKKMTVDEKIGQLRLISVG
PDNPKEAIREMIKDGQVGAIFNTVTRQDIRAMQDQVMELSRLKIPLFFAYDVLHGQRTVF
PISLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYL
TSIMGKTMVEAMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPY
KAGLDAGSGAVMVALNSLNGTPATSDSWLLKDVLRDQWGFKGITVSDHGAIKELIKHGTA
ADPEDAVRVALKSGINMSMSDEYYSKYLPGLIKSGKVTMEELDDAARHVLNVKYDMGLFN
DPYSHLGPKESDPVDTNAESRLHRKEAREVARESLVLLKNRLETLPLKKSATIAVVGPLA
DSKRDVMGSWSAAGVADQSVTVLTGIKNAVGENGKVLYAKGANVTSDKGIIDFLNQYEEA
VKVDPRSPQEMLDEAVQTAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLIAALKA
TGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFP
RSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGALYPFGYGLSYTTFTVSDVKLSA
PTMKRDGKVTASVQVTNTGKREGATVVQMYLQDVTASMSRPVKQLKGFEKITLKPGETQT
VSFPIDIEALKFWNQQMKYDAEPGKFNVFIGTDSARVKKGEFELL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggctatgttcagtaggaatcgcggtgagtctggccctgcagccagcactggcg
gatgatttattcggcaaccatccattaacgcccgaagcgcgggatgcgttcgtcaccgaa
ctgcttaagaaaatgacagttgacgagaaaattggtcagctgcgcttaatcagcgtcggc
ccggataacccgaaagaggcgatccgcgagatgatcaaagacggtcaggttggggcgatt
ttcaacactgtaacccgtcaggatatccgcgccatgcaggatcaggtgatggaattaagc
cgcctgaaaattcctcttttctttgcttacgacgtgctgcacggtcagcgcacggtgttc
ccgattagtctcggtctggcttcgtcttttaacctcgatgcggtgaaaacagtcgggcgt
gtctctgcttatgaagcggcagatgatggcctgaatatgacctgggcaccgatggtcgat
gtctcgcgcgatccgcgctggggacgtgcttccgaaggttttggcgaagatacgtatctc
acctcaataatgggcaaaaccatggtggaagcgatgcagggtaaaagcccggcagatcgc
tactcggtgatgaccagcgtcaaacactttgccgcatacggcgcggtagaaggcggtaaa
gagtacaacaccgtcgatatgagtccgcagcgcctgtttaacgactatatgccgccgtac
aaagcggggctggatgcaggcagcggtgcggtgatggtggcgctgaactcgctgaacggc
acgccagccacctccgactcctggctgctgaaagatgttctgcgcgaccagtggggcttt
aaaggcatcaccgtttccgatcacggcgcaatcaaagagctgattaaacatggcacggcg
gcagacccagaggatgcggtacgcgtggcgctgaagtccggaatcaacatgagcatgagc
gacgagtattactcgaagtatctgcctgggttgatcaaatccggcaaagtgacgatggaa
gagctggacgatgctgcccgccatgtactgaacgttaaatatgatatgggattgtttaac
gacccatacagccatttggggccgaaagagtctgacccggtggataccaatgccgaaagc
cgcctgcaccgtaaagaagcgcgtgaagtggcgcgcgaaagcctggtgttgctgaaaaac
cgtctcgaaacgctgccgctgaaaaaatctgcaaccattgcggtggttggcccgctggca
gacagcaagcgtgacgtgatgggaagctggtcggcggcaggtgtcgccgatcaatctgtt
actgtgctaacagggattaaaaacgccgtcggtgaaaacggtaaagtgctgtatgccaaa
ggggcgaacgttaccagtgacaaaggcattatcgatttcctgaatcagtatgaagaggcg
gtcaaagttgatccgcgttcgccgcaagagatgcttgatgaagcagtgcaaaccgcgaaa
caatctgatgtggtggtggctgtggtcggtgaagctcaggggatggcgcacgaagcttcc
agtcgtaccgatatcactattccgcaaagccaacgtgacttgattgcggcgctgaaagcc
accggtaaaccgctggtgctggtgctgatgaacgggcgtccgctggcgctggtgaaagaa
gatcagcaggctgatgcgattctggaaacctggtttgcggggactgaaggcggtaatgca
attgccgatgtattgtttggcgattataacccgtccggcaagctgccgatgtccttcccg
cgttctgtcgggcagatcccggtgtactacagccatctgaataccgggcgtccgtataat
gccgacaagccgaacaaatacacttcgcgttattttgatgaagctaacggggcgctttat
ccgttcggctatggtctgagctataccactttcaccgtctctgatgtgaaactttctgcg
ccgaccatgaagcgtgacggcaaagtgacggccagcgtgcaggtgacgaacaccggtaaa
cgcgaaggggccacggtagtacagatgtacttgcaggatgtgacggcttccatgagtcgc
ccggtgaagcagctgaaaggctttgagaaaatcaccctgaaaccgggcgaaactcagacc
gtcagcttcccaatcgatattgaggcgctgaagttctggaatcaacagatgaaatatgac
gccgagcctggcaagttcaatgtcttcatcggcactgattccgcacgcgttaagaaaggc
gagtttgagttgctgtaa

DBGET integrated database retrieval system