KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_3194
Entry
ECOK1_3194        CDS       T01997                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eih00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eih02044]
    ECOK1_3194
Secretion system [BR:eih02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECOK1_3194
SSDB
Motif
Pfam: VipB VipB_2 P2_N
Other DBs
NCBI-ProteinID: ADE90683
Position
3256273..3257811
AA seq 512 aa
MSVQQEHSTSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERV
TAAIHVLLSCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGT
WFVVQRTDFRKNVRIELLDISKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASL
ISSYEFDNSPQDIALLRNISRVSAASHMPFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRA
EYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHEKYLWTNAS
FAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSEVMIPETREFE
FANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPG
FFRVRLFAVPHFQIEGMDINLSLVSQMPKAKA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtctgtacaacaagaacattccacctctgaaactgcaacactcaccaccactgagtcc
ggcggcgtttatcagtccctgttcgataaaattaatttaaccccggtctcttccattcag
gaaatagatttatggcaaaacagcgaaacgctggctgatgcctcacccgatgagcgcgtg
acagcagcgattcacgttctgctttcctgtctggcgaaatcaggcgaggacgtggttaag
ctcgacaagagcctgctggattttcatatcgacgatctggatcagaaaatcagtaaacag
cttgatgcggtcatgcaccaccctgaattccagaaagtcgagtcgctgtggcgtggtaca
tggttcgtcgtacagcgcactgattttcgcaaaaatgtcagaattgaattgctggatatc
agcaaagagcatctgcgtcaggatttcgacgactccccggaaatcattcagagcggttta
tatcgtcatacatacattcaggagtacgatacgccgggtggcgaacctgttgcctcatta
atttccagctatgaatttgataacagcccgcaggatattgccctgctgcgcaatatttcc
agagtgtctgccgcttcccatatgccttttatcggttccgtcggaccgaaattcttcctt
aaaaattcgatggaagaagtcgccgcgattaaagatatcggcaactactttgaccgcgca
gaatatattaaatggaagtcgttccgcgatacggatgacagccgctatgtgggattagtg
atgccgcgagtgctgggccgtctgccctatgggccggacacggtgccggtacgcagcttt
aactatgtggaagaagtcaaaggcccggatcacgaaaagtacctgtggacaaacgcctcg
ttcgcctttgccgccaatatggtgaagagctttgtgaataatggctggtgtgtgcagatc
cgtggtccacaggcaggtggcgcagtagccgatctgcccatccatctttacgatctcggc
accggcaatcaggtcaaaattccgtccgaagtgatgatcccggaaacccgcgaatttgaa
tttgccaaccttggctttattccgctctcttattataagaatcgcgattacgcctgcttc
ttctcggcaaactccgcccagaaaccggcgttgtatgataccgctgacgccaccgccaac
agccgtattaacgcccgtctgccttacatcttcctgctgtcccgcattgcgcattacctg
aaaatcattcagcgcgagaatatcggtaccaccaaagaccgccgcgtactggaactggaa
ctgaacacctggatccgcacactggtgacggagatgaccgatccgggtgatgaactgcag
gcgtctcacccgctgcgcgacggcaaggttatcgtggaagatattgaggacaatccgggc
ttcttccgcgtcagactctttgccgtgccgcatttccagattgaagggatggatatcaac
ctttctctggtttcccagatgccgaaagcgaaagcctga

DBGET integrated database retrieval system