KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_3196
Entry
ECOK1_3196        CDS       T01997                                 

Definition
(GenBank) type IV/VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eih00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECOK1_3196
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eih02044]
    ECOK1_3196
Secretion system [BR:eih02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECOK1_3196
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ADE92028
Position
3259163..3259828
AA seq 221 aa
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENV
EHITYAQCALLDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAP
AQAVLTCFHRVLLLGFRGRYQDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQH
PLLHSPFFWLVTLALLLAGVWWGLHHWLNVLVDELLPQSLR
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaaaaagatatggatatcaatatcgatgcgctgctgcgcgacacgtttctgacggtg
gtggaactgcgtcagggaaccaccgtgcgtcacggtatcgagctgtatcgccactgtcag
cggcaggtggaactggtccgcgaacgtctgaaagatgccggattcagtcgggagaacgtg
gagcacataacttacgcgcagtgcgccctgctggacgaaacggtgctcagccgtagtggc
atggacgacggtcaggccatctggatgaaaaacccactccagtcgcatttcttcaacacc
ctgcaggccggtgagctgctgtacgagcggatgaagcaggtgctacaggaacccgccccc
gcgcaggccgtgctgacctgctttcaccgtgtcctgctgctgggatttcgcgggcgttat
caggatccggcagccccggagcgcgaccagcttatttcgacgctcaacgggcaggtcgcg
ccatttggtgtgctgccggaaacggcggtactgaacgtgccgttatccacccgtcagcac
cctttgctgcattcgccatttttctggctggtaacactggcgctgctactggcgggcgtc
tggtgggggctacaccactggctgaatgtactggtggatgaactgctgccgcaaagcctg
cgttaa

DBGET integrated database retrieval system