KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_3197Help
Entry
ECOK1_3197        CDS       T01997                                 

Definition
(GenBank) OmpA domain protein
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA
Motif
Other DBs
NCBI-ProteinID: ADE92636
Position
3259841..3261493
Genome map
AA seq 550 aa AA seqDB search
MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTG
DAGLSSLPPETYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTL
RPAWASQLAVAYTIMPGIHRDVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPL
PERASSPWFICTGGEVQVATSTENAMPAQWIAQSGVQERSQRLSYLLKAESLMQWLDLNV
LAELNGPEAKCPPLAMAVGLVPSLPAVDNNLWQLWITARTGLTPDIADTGTDDALPFPDA
LLRRLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDDLHRFYAVPVE
EFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDE
KSNQQLSLRRAEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLV
PRSDACQDVK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaacacgctgaaacaggccatcgtgctgtggggaatggtgttactgctggtgctg
tggtcagtgtttatcagtccgtctggcgtgctgagatgggccggtgcggcggctatcgtt
ctggcggttgctgcgttgttgatttatcggcgcaggcaggcgtggacggagatgaccggc
gatgccgggttgtcatcgctgccgccggaaacctaccgacagccggtagtgctggtctgt
ggcggtctgtcggcgcacctgttcactgacagcccggtccgccaggtttcagaagggctg
tatctgcatgttcctgatgaagaacagcttgtggcgcaggtggagcgattgctgaccctt
cgcccggcgtgggcatcgcagcttgccgtggcgtataccatcatgcccggcatacaccgg
gatgtggcggttctggccggacggctgcgacggttcgcccacagtatggcgacggtgcgt
cgtcgggcaggcgtaaacgtcccctggcttctctggagcgggctgtccggctcgccgttg
ccggaaagagcgagttcaccgtggtttatctgtaccggcggcgaagttcaggtagcaaca
tccacagagaacgcgatgcccgcgcagtggattgcacaatccggcgtacaggaacgcagt
cagcgactctcttatctgctgaaagccgaaagcctgatgcagtggctggatcttaatgtg
ctggcggaactgaacggcccggaggcgaaatgtccaccactggcgatggccgtggggctg
gtcccctcgttgcctgcggtggataacaacctgtggcagttgtggatcaccgccagaacc
ggcctgacgccggatatcgcggacaccggcacagacgatgcgctgccattcccggatgcc
ctgttacggcggttgccgcgtcagtcgggctttaccccgctgcgacgggcctgcgtgacc
atgctgggcgtcaccaccgtggcgggtatcgccgcgctgtgcctgtcagccacggcaaat
cgccagttattacggcaggtcggtgacgatctgcaccggttttatgccgtcccggtggag
gaatttatcaccaaagcccgtcacctgtcggtgctgaaagacgatgcgaccatgctcgat
gggtattaccgggaaggagaaccactgcgcctcggtctggggttataccccggcgaacgc
atccgccagccggtattacgcgccattcgcgactggcgtccgcctgaacaaaaaatggag
gtgacggcttcgcttcaggttcagaccgtgcgtcttgacagtatgtcgctgtttgacgtc
ggacaggcccgcctgaaagacggctcgacaaaagtgctggtggacgcactggtgaacatc
cgggcaaaaccgggctggctgatcctcgtggccggatataccgatgccaccggcgatgaa
aaaagcaatcagcagttatcgctgcggcgtgccgaagcggtgcgcaactggatgctgcag
accagcgacatcccggccacctgttttgccgtacagggactgggcgagagccagcctgcg
gcgaccaacgacacgccacagggccgggcagtcaaccggcgtgtcgaaatcagtcttgtt
ccgcgttctgacgcctgtcaggacgtgaaataa

DBGET integrated database retrieval system