KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_4098Help
Entry
ECOK1_4098        CDS       T01997                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:eih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECOK1_4098
Enzymes [BR:eih01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     ECOK1_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 AraC_binding PB1-F2
Motif
Other DBs
NCBI-ProteinID: ADE92330
Position
complement(4203506..4204186)
Genome map
AA seq 226 aa AA seqDB search
MKRSQINYVIDKAHAIAQTFRVCLPEFAYFTVDDWLQRERDNWQEVVDLQLGWDITDFGR
GDFNQTGLTLLTMRNGALGSAAYPKPYAEKMLQIQQDQQTPWHFHTHKMEDILNRGGGDL
CMRLAWANEANLCDDQRVITVSVDGQRRTMKPGETLVLKPGQGICLPPRLYHRFWAEKAF
VLGWEISMVNDDQHDNYFLEPGGRFPAIEEDEPVKWLLCGEYGILR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcacaaattaattatgttattgataaagcacatgccattgcgcagaccttc
cgcgtttgtttgccagagttcgcctattttacggtggatgactggctgcagcgggaacgg
gataactggcaagaagtggtcgacttacagctcggttgggatatcaccgattttggtcgt
ggtgatttcaaccaaacgggactaacactgctaacgatgcgcaacggcgcgctggggtcg
gcggcatatccaaaaccgtatgctgagaaaatgttgcagatccaacaagatcagcagact
ccctggcattttcacacccacaaaatggaagatatcctcaatcggggcggtggagactta
tgcatgcggttggcctgggccaacgaagccaatctctgtgatgatcaacgagtcattacc
gtgagtgttgatggtcagcggcgtaccatgaaacctggtgaaacgctggtgctaaagccg
gggcagggcatttgcctgccgccgcgtctgtatcatcgcttctgggcggaaaaagcgttt
gttctcggctgggaaatctcgatggtaaatgatgaccaacacgataattattttcttgag
ccgggaggacgttttccggcgatagaagaagatgaaccggtgaaatggttattgtgcggt
gagtatggaattttgcgctaa

DBGET integrated database retrieval system