KEGG   Encephalitozoon intestinalis: Eint_011150Help
Entry
Eint_011150       CDS       T02238                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ein  Encephalitozoon intestinalis
Pathway
ein00230  Purine metabolism
ein01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Eint_011150
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Eint_011150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Thymidylate_kin AAA_17 AAA_22 AAA_5 APS_kinase AAA_29 MMR_HSR1 Zeta_toxin AAA_16 NTPase_1 AAA_23 ABC_tran RsgA_GTPase SKI AAA_24 dNK ADK cobW FtsK_SpoIIIE AAA_21 AAA_14 SKA2 SMC_N Dynamin_N T2SSE AAA_19 RNA_helicase AAA_28 DAP3 AAA Cytidylate_kin AAA_30
Motif
Other DBs
NCBI-GeneID: 9698630
NCBI-ProteinID: XP_003072337
UniProt: E0S5J2
Position
I:complement(120983..121537)
Genome map
AA seq 184 aa AA seqDB search
MDKAHLVLTGPSGSGKSTIISHILSRFPFGFSVSHTTRQPRKGEVNGKDYFFVTTEEFES
MVKRQELLEYIKYNGNYYGTGSDQLKVSEKAILMDLEYDGVMYCRKNYPNFVVVYIDCDK
DVAYERLKKRMENKNREDEVKGRMKLYEKFDSIKKDCDYVIDNTHSLERSKKEIEEIISK
EFKF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggataaggcacatctagtactcaccgggcccagtggatccggaaagtccactatcata
agtcacattctatctaggtttccttttgggttttcggtgtcacacacaaccaggcaaccg
agaaaaggagaggtgaatggaaaggattatttttttgtgacaacagaagagtttgagtcg
atggtaaaaagacaggaacttttggagtatatcaaatacaatggaaactactatggaaca
ggttctgaccagctgaaggtctctgaaaaggcaatattgatggatttggaatatgatgga
gtcatgtattgtagaaagaactacccaaacttcgttgttgtgtatattgattgtgataaa
gatgttgcctatgagaggttaaagaagaggatggaaaacaaaaacagggaggatgaagtg
aaggggagaatgaagttatatgaaaaattcgattctatcaagaaagactgcgactatgtc
atcgacaacactcattctcttgagaggtccaaaaaggaaattgaagagattatatccaag
gaattcaagttctag

DBGET integrated database retrieval system