KEGG   Encephalitozoon intestinalis: Eint_011310Help
Entry
Eint_011310       CDS       T02238                                 

Definition
(RefSeq) Cdc3-like septin
  KO
K16944  septin 7
Organism
ein  Encephalitozoon intestinalis
Brite
KEGG Orthology (KO) [BR:ein00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ein04131]
    Eint_011310
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ein04812]
    Eint_011310
   04147 Exosome [BR:ein04147]
    Eint_011310
Membrane trafficking [BR:ein04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    Eint_011310
Cytoskeleton proteins [BR:ein04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     Eint_011310
Exosome [BR:ein04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Eint_011310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase Dynamin_N AAA_24 AIG1 Roc FtsK_SpoIIIE AAA_33 ABC_tran
Motif
Other DBs
NCBI-GeneID: 9698606
NCBI-ProteinID: XP_003072353
UniProt: E0S5K8
Position
I:complement(142433..143548)
Genome map
AA seq 371 aa AA seqDB search
MSQKGIGVSNLPNVKYRSFCKAGIDFNIMIIGSSGLGKSSFINQMLGEPVLSSDPFLKED
DGNQSNEITRVSDTDGAEEQEDRYFHRNSLINIQISKFFVMENEFQTRITVAEVDGVGDN
VCNEECWVPVVELIQNNFKDYLEQERKNVRPLIKDKRIHICLYFLEPNPSHVKLVDIKTM
KEISKICNLIPVVGKSDLLSDLERQECSDRIAEAISAENIDVFYLDVPDRERIGKSEYPF
FVIAKNVDHEDTPGHNREYPWGTMVPEKVGSNDFYLLVDSLIAKNLIKLVEATETFYDDY
KTKEIGRSIANKPEILGEDDKKLTREIQKKIKEDEKTIAELRQRLIEKRKYYESKLLEMV
DNHRDEEINSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaaggtataggcgtgtccaacctcccaaatgtaaaatatcgaagcttttgc
aaggcaggaatagatttcaacataatgataatcggctcaagcggcttggggaaatcatct
ttcatcaatcagatgctaggtgaacccgttctgtcctccgatccgtttttgaaggaggac
gatggaaaccagagtaatgagattactagggtgtccgatacagatggagccgaagagcag
gaagatagatattttcacaggaactctttgattaatattcagatatcgaagttctttgtc
atggaaaatgagtttcaaacaagaattaccgtggccgaggtggatggagtgggagataat
gtctgtaacgaggaatgctgggtacctgttgtggagttgattcagaataacttcaaagac
tacctagagcaagagaggaagaatgtcaggccattgatcaaggataaaagaatccatatc
tgcctttacttcttggaacccaatccatctcatgtgaagcttgtggacataaagaccatg
aaggagatatcgaagatttgcaacttaattccagtggttgggaagagcgatcttctgagc
gacttggaaagacaggaatgcagcgacaggattgcagaggctatatctgcagaaaacatc
gatgttttttacctagatgtgccagacagagagagaatcggtaaatcggaatatcctttt
tttgtcattgcaaagaacgttgaccacgaagacaccccagggcacaacagagaatatcca
tggggaacaatggttcctgaaaaagtgggaagcaatgatttttaccttctggttgactct
ctgatagcaaagaatctcataaagcttgtagaagcaacagagacgttttatgacgactac
aagactaaagagattggcaggtcaatagcaaacaaaccggagattcttggggaggatgac
aagaagctaacaagggaaatacaaaagaagatcaaagaagacgaaaagactattgcagag
ctaaggcagagactgatagaaaaaagaaaatattacgagtcaaaactgctggagatggta
gataatcacagggacgaagaaataaattcctcttag

DBGET integrated database retrieval system