KEGG   Entamoeba invadens: EIN_085930Help
Entry
EIN_085930        CDS       T04133                                 

Definition
(RefSeq) ATP-dependent RNA helicase HAS1, putative
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
eiv  Entamoeba invadens
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eiv03041]
    EIN_085930
   03009 Ribosome biogenesis [BR:eiv03009]
    EIN_085930
Enzymes [BR:eiv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EIN_085930
Spliceosome [BR:eiv03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    EIN_085930
Ribosome biogenesis [BR:eiv03009]
 Eukaryotic type
  90S particles
   Helicases
    EIN_085930
  Pre-60S particles
    EIN_085930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII AAA_22 Mem_trans Otopetrin JCAD DDHD
Motif
Other DBs
NCBI-GeneID: 14884150
NCBI-ProteinID: XP_004184687
Position
Unknown
AA seq 566 aa AA seqDB search
MSRKRTAAEVFPEEETPEKIVDDNAETVTEYHKNSQESEESKEHTEESSSDESEESEKEE
KQEEKAELKEEEKPVENEEKKEDAKAKVSEKKKGETPKTSSFLTERKFSALKLSDEVQDA
LDEAGFTFMTTIQERTAPLLLTGRDVLAKARTGSGKTLAYLVPVLDLLNKIKFTSRNGTG
AIIISPTRELALQIYEVLEKLMQNSERSKALLIGGNPKKKDEEVLENGACVVVATPGRLL
DHLSNTRCFLFKNLKCLVIDEADRILEAGFEDEMRQILNRLPKNRQTMLFSATQTDKVED
MANLSLKDPVFVNVEESSTTATSSKLQQGYVLVESKDRFRLLYTFLRKYKGKKMIVFMSS
CNAVKFYSNLLNYIDTPVLSLHGQLKQDKRTKVFEKFCKTKNCILLTTDVAARGLDIPEV
DWIIQMDLPDGPTEYIHRVGRTARADTEGKAVMFLQPTEIAMLKYMKEKQIPLTQYEVPE
KKIANVQQELEKLVAKNVFLHQDAKEAYKSYLMAYNSHKQKDVFNLNQIDVEGLAKSFGM
PNPPKVQLAMMKSPKSKDRFEPRRKY
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggaagagaacagcagcggaagtattcccagaagaggaaacgccggaaaagatt
gtggacgacaatgcagaaacagtgactgagtatcacaagaattcacaagaaagcgaggaa
agcaaagaacatactgaagagagttcgagtgatgaatctgaagagagtgaaaaggaagag
aaacaagaagagaaagcggaattaaaagaagaagaaaaacctgtggaaaatgaagagaaa
aaagaagacgcgaaggctaaggtgtctgaaaagaaaaaaggagaaacgccaaaaacgtct
tcatttttaactgaaagaaagttctcggctttgaaactgtcggacgaagttcaagacgca
ctcgacgaagcgggcttcacttttatgacaacaattcaagaaagaacagctcctctcttg
ttgactggaagagatgtgttagctaaggctcgaacgggctctggcaaaacccttgcgtat
ttagttccagttttggacttattaaataagattaagtttacatcaagaaatggcactggt
gctattatcatatcaccaacacgagagttggctcttcagatatacgaagtgttagaaaaa
ttgatgcagaactcggagaggtcgaaagccttattgattggaggaaaccctaagaaaaaa
gacgaggaggtcttagagaatggtgcttgtgtagttgtggcgacaccgggaagattgttg
gaccacttatctaacacaagatgttttcttttcaagaacttgaagtgtttagttattgac
gaggcagacagaattttggaggcagggtttgaagatgagatgcgacaaattctgaacaga
cttccaaagaatagacaaacgatgctcttttcagcaacacaaacagacaaagtagaagat
atggctaatttgtcgttgaaagacccagtctttgtgaatgtagaagaaagttcgaccact
gcgacttcaagtaaactgcaacaagggtatgttctagttgaaagtaaagaccgattcaga
cttctttatacatttttgaggaagtataaagggaagaagatgattgttttcatgtcctcg
tgcaatgcagtgaagttctattcgaatttattgaattacattgacacccccgtcctttct
ctacatggacagttgaaacaagacaaacgaacaaaagtctttgagaagttctgtaagacc
aaaaactgcattttgttgacaacagacgttgcagctagaggattggatatcccagaagtc
gattggattattcaaatggatttgccagatggaccaacggagtatatacatcgagtggga
agaacagcaagagcagataccgaaggaaaggctgtcatgtttctgcaaccgactgaaatt
gcgatgttaaagtatatgaaagagaagcaaatacctttgacacaatatgaagtgcctgaa
aagaagatcgcaaacgtccaacaagagcttgaaaagcttgttgcgaagaatgtcttttta
caccaagacgctaaagaagcttacaaatcatatttgatggcgtacaatagtcataaacag
aaagacgtcttcaacttgaatcaaatcgacgtggaaggccttgcgaagtcatttggtatg
cctaacccacctaaggtccagctcgcaatgatgaagtcaccaaagagcaaagaccgtttc
gagccgaggaggaaatactga

DBGET integrated database retrieval system