KEGG   Entamoeba invadens: EIN_095610Help
Entry
EIN_095610        CDS       T04133                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 precursor, putative
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
eiv  Entamoeba invadens
Pathway
eiv00010  Glycolysis / Gluconeogenesis
eiv00562  Inositol phosphate metabolism
eiv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EIN_095610
   00562 Inositol phosphate metabolism
    EIN_095610
Enzymes [BR:eiv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     EIN_095610
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     EIN_095610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 14886411
NCBI-ProteinID: XP_004254075
UniProt: A0A0A1U097
Position
Unknown
AA seq 422 aa AA seqDB search
MLLSVFLFTILCRSEDVYISKHFATATPYPQYYKRDPTIDHYEVIYSELVSRHGARYPTE
KNTLASIALSELLNSKSHIKWDSPFTLEKQGQLCERGEDELLRLGTYYKTMLNSLYKGKG
LSLFNVSATAVPRAQDSAVYWMKGFSFDEPENLKLIEEKKMNITVAQIEDDMLLYFHKCC
QKYIKYKKLPSTKAESKSFMEAAALKISKHFVSQTGLTQITQEETLEATAAAFNSAVYEY
IVFNKTNGLLKYFSVQDAEVFEYAKDLETYFTKSVSTALNYKMAIPLLHTILEALRNAME
NNKEKHKQIVLGNFRFAHAETVTPLMVLLGIKYDKYPLTAKLPLDLKINRQWKMSELSPF
STHLMFVVLKDKTGNYYVRTYMNQRPVVVPPCPSSTICEAETFLKYYYNVTRGFDFNAFC
EN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttgttatctgtgttcttattcacaattttgtgtcgaagcgaagatgtctatatttca
aaacactttgcaacagccacgccatatccccaatattacaaacgcgatccaactatagac
cattatgaagtcatttactcagaattggtgagtcgtcatggagcaagataccccacagag
aagaacacattggcttcaattgctctttcggagcttctcaattcgaagtctcacattaaa
tgggacagtccatttacgttagaaaagcaaggccagttatgtgaacgaggcgaagacgag
ttgttgaggttagggacatattacaagactatgttaaacagtctttataaagggaaaggt
ctttcactgtttaatgtgagtgctacagctgttccccgtgcacaagacagtgcggtgtat
tggatgaaagggttttcctttgacgagcccgagaatttgaaactgattgaagagaagaag
atgaacatcactgtcgcacagattgaagacgacatgttactttactttcacaagtgttgt
cagaaatatataaaatacaaaaaactgccgtcgacgaaagcggagagtaaaagtttcatg
gaagccgcggctcttaaaatttcaaagcattttgtgagtcaaacaggactgactcaaatc
actcaagaagaaactttggaagccactgcggcggcttttaattcagctgtgtatgagtac
atcgtctttaataagacaaatggattactgaaatacttcagtgttcaagacgcggaggtc
tttgaatatgctaaagacctcgaaacctattttactaagagcgtgtcgacggctttgaat
tataaaatggctattccactgttacataccattttggaggctcttaggaatgctatggaa
aacaataaggaaaagcacaaacaaattgtgttgggaaatttcaggttcgcacacgcggaa
acagttacaccgttgatggtgttattgggcattaaatacgacaaatatcccctcacagca
aaactcccattggacctcaaaattaatcgacagtggaaaatgtcggagctatcgccgttt
tctacacatctgatgttcgttgtactcaaggacaaaacaggcaattactacgtgagaaca
tatatgaatcaaagaccagtggtcgtaccaccgtgtccttcatcgactatatgtgaagcg
gaaacgtttttaaagtattattataacgtcactcgtggatttgactttaatgcattttgt
gagaattga

DBGET integrated database retrieval system