KEGG   Entamoeba invadens: EIN_143170Help
Entry
EIN_143170        CDS       T04133                                 

Definition
(RefSeq) heat shock protein, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
eiv  Entamoeba invadens
Pathway
eiv03040  Spliceosome
eiv04141  Protein processing in endoplasmic reticulum
eiv04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EIN_143170
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EIN_143170
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    EIN_143170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eiv01009]
    EIN_143170
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eiv03041]
    EIN_143170
   03009 Ribosome biogenesis [BR:eiv03009]
    EIN_143170
   03110 Chaperones and folding catalysts [BR:eiv03110]
    EIN_143170
   04131 Membrane trafficking [BR:eiv04131]
    EIN_143170
   03051 Proteasome [BR:eiv03051]
    EIN_143170
   03029 Mitochondrial biogenesis [BR:eiv03029]
    EIN_143170
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eiv04147]
    EIN_143170
Protein phosphatases and associated proteins [BR:eiv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EIN_143170
Spliceosome [BR:eiv03041]
 Complex B
  Other components
   Prp19 complex
    EIN_143170
 Complex C
   Prp19-CDC5 complex
    EIN_143170
Ribosome biogenesis [BR:eiv03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    EIN_143170
Chaperones and folding catalysts [BR:eiv03110]
 Heat shock proteins
  HSP70 / DNAK
   EIN_143170
Membrane trafficking [BR:eiv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    EIN_143170
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    EIN_143170
Proteasome [BR:eiv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    EIN_143170
Mitochondrial biogenesis [BR:eiv03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    EIN_143170
Exosome [BR:eiv04147]
 Exosomal proteins
  Proteins found in most exosomes
   EIN_143170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 14890460
NCBI-ProteinID: XP_004258238
UniProt: A0A0A1U9E5
Position
Unknown
AA seq 231 aa AA seqDB search
MYCCNSIPSPLVRFIYATHLVVIVGVKGEDGKTNAEWQQNKSSYVAFTDSERLIGDTAKN
QIAMNVKNTVFDAKRLIGRRFSDPTIQEDMKHWSFTVVNNGNDKPLIQVEYKGETKKFTL
KEISSMALTKMKETAEAFVGGKVNNAIITCPAYFNDSQRQATKDAGTIAGINVLRTINEP
TAAAIAYGLDKKTEREKNVLIFDLGGGTFDVSLLAIDDGVFEVKATNGNTP
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtactgttgtaatagtataccatcacctcttgttagattcatttacgcaactcattta
gttgtgattgttggtgttaaaggtgaagacgggaaaacaaatgcagagtggcaacagaac
aagtcatcgtacgttgccttcacagacagtgagaggctgattggcgacacagcaaagaac
cagattgcgatgaatgtgaagaatacagtctttgatgcaaagagactgattggaagacgc
ttcagtgacccaacaattcaagaggatatgaagcactggtcattcactgtcgtcaacaat
ggcaatgacaagccgttgattcaggtggagtacaagggtgagacaaagaagttcacatta
aaggagatcagttcgatggcgctgacgaagatgaaggagacagcagaggcgtttgttggt
gggaaagtcaacaacgcaatcatcacatgtccagcctattttaacgattcacagcgacag
gcaacaaaggatgcgggcacaattgcaggcatcaatgtgcttagaaccatcaatgagcca
acagcagcagcaatagcatatggacttgacaagaagacggagagagaaaagaacgtcttg
atctttgatcttggtggtggaacatttgatgtgtcacttcttgctattgacgatggcgtc
tttgaagtgaaggcaacaaacggcaacacaccttaa

DBGET integrated database retrieval system