KEGG   Entamoeba invadens: EIN_185220Help
Entry
EIN_185220        CDS       T04133                                 

Definition
(RefSeq) zinc finger protein DHHC domain containing protein, putative
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
eiv  Entamoeba invadens
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eiv04131]
    EIN_185220
Enzymes [BR:eiv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     EIN_185220
Membrane trafficking [BR:eiv04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    EIN_185220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC PHF5 Promethin
Motif
Other DBs
NCBI-GeneID: 14892920
NCBI-ProteinID: XP_004260916
Position
Unknown
AA seq 340 aa AA seqDB search
MINPYYYDSPQKVSTNQHQEDSWEETKKDLMKGPYLLKRKTGGPEEDESSDRVMMIVAIT
LISVAFLSTLYAFFHLPLVFFLTTPIPLFTFACLVFAYYKAVTTDPGRCVGYNPNKSEED
KKAAIERETFGKEKGFKIVDIGYPVRYCTTCQGFRCERAYHCKKCGSCIKKRDHCPWISQ
CVGENNLRYFVQFLMLVPLNCLFGVLIQIGYIIKMLAGFGKGEYSADVFFMIIAVVITII
MFSMGFAVATLMVNHVGMVLENTTSMEEIEKTRYDYLTHDKAPFFPSYSTTKYRNWKEVM
GGNVLVWLIPFFANPNSTESKNTVDVLVDDQNVEVNIQNE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacccatattactacgattcccctcaaaaagtttcaacgaaccaacaccaagaa
gacagctgggaagagacaaaaaaagatttaatgaaagggccatatcttctaaaacggaag
actggtggaccagaggaggacgagagttctgacagagtgatgatgatagttgctatcact
ttaatctccgttgcattcttatccacactatacgcctttttccatctccccctcgtcttc
ttcttaaccacaccaatcccactcttcactttcgcgtgtttagtcttcgcttattacaaa
gccgtcacgactgacccggggagatgtgtcgggtacaatccaaataagtctgaagaagac
aagaaagctgcaatagaacgggagacgtttggtaaagaaaaaggctttaaaatagtcgat
atagggtatccagtaaggtactgtacaacgtgtcaggggtttaggtgtgagagagcttat
cactgcaagaagtgcggttcatgtatcaagaagagagatcattgtccgtggatttcacag
tgtgttggagagaacaatttgagatattttgtacagtttttgatgctcgttccgcttaac
tgtctttttggagttttaattcagattggatatatcatcaaaatgctggcaggtttcggg
aaaggggagtattctgccgacgtgttttttatgataattgctgtggtaatcacgataatc
atgttttcaatgggatttgcagtcgctactctcatggtcaatcacgtcggaatggttctg
gaaaatacaacatcgatggaggagattgagaagacgagatatgattacttgacgcatgac
aaagctccgtttttcccaagttattcaacaacaaaatacagaaattggaaagaggtaatg
gggggtaatgtattagtgtggttgatcccattttttgcaaacccaaacagcacagaaagt
aaaaatacggtcgatgtcttggtcgatgatcagaatgtagaagtcaatatacagaatgag
tga

DBGET integrated database retrieval system