KEGG   Entamoeba invadens: EIN_405020Help
Entry
EIN_405020        CDS       T04133                                 

Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
eiv  Entamoeba invadens
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eiv03041]
    EIN_405020
   03009 Ribosome biogenesis [BR:eiv03009]
    EIN_405020
Enzymes [BR:eiv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EIN_405020
Spliceosome [BR:eiv03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    EIN_405020
Ribosome biogenesis [BR:eiv03009]
 Eukaryotic type
  90S particles
   Helicases
    EIN_405020
  Pre-60S particles
    EIN_405020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4217
Motif
Other DBs
NCBI-GeneID: 14889122
NCBI-ProteinID: XP_004256859
UniProt: A0A0A1U6P4
Position
Unknown
AA seq 487 aa AA seqDB search
METIAVKTVSDSHKVLMDGLESGKSVYLDTRFEWDIGTVITDYIVKISSEFPKYNEDDIS
EENKGGPYALILCGDDEEVARIHSITKSQTSLNVGVFPNPSPIETTCEKTKKKYPIFIGT
VSGILSEMFLMDKGYPSQNLRFVAFLSGASIVRAGLERYILKIANRIPQCQLFVENTGNF
SEDVMASLKCNYKIVVDEKPDIQQQVSCLYYKPEAKGNLIASIIQRNKGKKIAFLFLSSE
EAVFFQDVMSRLELVDGYVLNNTQTLNEQIEVITQFNEKADGVMFSAQERKFKNVDLAIF
VDPPKELLNVRYPGAGNIILFGLESEKLFFEKLGEKRTLKTIKMVENQLNDYSPKIEQLV
AKQYFVHVNARTAYQRFLQNYVHLDFMGVFGLKRNELIPYAHSFGLTKPVKTNLANTTSK
EVPDVPVVYEKKVFVGSDATVSRLRDRQKELKNARLMKKLEIGKGKRTKKSKSKNKSKKR
QVRRNKK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagacaattgcagtgaagactgtatcagactcacacaaagtacttatggacggcctt
gagtctgggaagagtgtatatttagatactcgttttgaatgggacattggtactgttata
actgactacattgtgaaaatatcaagcgaatttccaaagtacaacgaagacgacatttca
gaagaaaacaaagggggtccatacgcattaatattatgtggcgatgatgaggaggttgct
cgcattcactccattaccaaatcacaaacgtcactcaatgttggtgtttttccaaatcca
agtccaattgaaacgacatgtgaaaaaaccaagaaaaagtatccaattttcattgggact
gtttctggtatattatctgaaatgtttttaatggacaaaggatacccttcacagaatctc
agatttgtagcgtttttgtccggggcgagcatagtcagagctgggcttgagaggtacatc
ttgaaaatagcaaatcgaattcctcaatgtcagctgtttgttgagaacaccggaaatttc
tcagaggatgtgatggcttcattaaagtgcaattataagatcgtcgttgacgagaaaccc
gatattcaacaacaagtcagttgtttatattataaacctgaagcgaaggggaacttaatt
gcttcgatcattcaacgaaacaaagggaagaaaattgcgtttttgttcttgtcttcggag
gaagcggtgttcttccaggatgtgatgagtcgtcttgaacttgtcgatggatatgttttg
aacaacacacaaacattaaatgaacaaattgaagtgatcacacaattcaacgaaaaggcg
gacggcgttatgttctctgcgcaagagagaaaattcaaaaacgttgatttggctatattt
gtcgatccacccaaagagttattaaatgtccgctatcccggtgctggtaatatcattctc
tttggccttgaaagtgagaaactgttctttgagaaacttggagagaaaagaacactcaaa
acgattaaaatggttgagaatcaactgaatgactattccccaaaaatagagcaacttgtt
gcaaagcaatattttgttcatgtgaatgcaagaacagcatatcaacggttcctccaaaat
tatgtgcatttggatttcatgggcgtttttggattaaagagaaatgaacttattccttac
gcgcattcatttggtcttacaaaacctgttaagacgaatttggctaatacgacttcaaaa
gaagtacccgatgtccccgtcgtgtacgagaaaaaggtgtttgtcggatcggatgcgacc
gtgtccaggttaagagatagacaaaaggagttgaagaacgctaggctgatgaaaaaactc
gaaattggaaaaggaaagagaaccaaaaaaagtaaaagcaaaaataaatcgaagaaaaga
caggtaagaagaaacaaaaaatga

DBGET integrated database retrieval system