KEGG   Entamoeba invadens: EIN_491160Help
Entry
EIN_491160        CDS       T04133                                 

Definition
(RefSeq) serine/threonine protein kinase, putative
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
eiv  Entamoeba invadens
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eiv01001]
    EIN_491160
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eiv03036]
    EIN_491160
Enzymes [BR:eiv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     EIN_491160
Protein kinases [BR:eiv01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   EIN_491160
Chromosome and associated proteins [BR:eiv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     EIN_491160
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    EIN_491160
  Sister chromatid separation proteins
   Polo kinases
    EIN_491160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal POLO_box
Motif
Other DBs
NCBI-GeneID: 14887994
NCBI-ProteinID: XP_004255728
UniProt: A0A0A1U3Z9
Position
Unknown
AA seq 539 aa AA seqDB search
MKGKGSSKKVISINDPSVAKDFSPISQIVEENGKKVTRVWEKVKFLGSGGFGTVFKVVDK
KTQEELAVKVILREPLKGTVLQKLRSEVQIHSDLDNDRIVKMREVFEDVEKKYIYILLDL
CNMETLKEVSSRRRRLHEPEIAYWMKEVIEGVIYLHQQKVIHRDLKLANIFIHDMHVKIG
DFGLAAQLDSNSTTRKTMCGTPTSMAPEIITKTGHSYAVDIWAIGVMLYYLKFGMTPFGS
TSRDHVYDKIKKCEYGFPPTKRISDALVKLIDNSLMKDPTKRPTADQLLQFAFFDPHVVP
ASLPEDSLMHDIDIRNLVYCGENEDKKVQLPEIESIKRSMKAMITKRPAVNAVVTEGKEY
NVIIDYLDKTDKYGVIYLMEDSTVGGRFNDNTTIFFYGDYYSYYGKDLSKLDVAANEIDK
QTHDVNKKCRIIKGFLKNLEGGDKTKKDLKMCLVRKYNKEERFSTFIFEDNSMEIFFGKE
VAYFVNPYQENLIVIKNRQKYPFELDKSKIRQVDPRCDEHFGLLNLVLDELANKIVVIN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaggggagtagcaagaaggtgatatctatcaacgacccgtctgtagcgaaa
gactttagtccgatttcacaaatagtcgaggaaaacggaaagaaagtgactcgggtctgg
gagaaagtcaagtttttaggaagtggtgggtttgggacggtcttcaaagtagtcgataag
aagacacaagaggaacttgccgtgaaagtcatattaagagaaccacttaaaggcacggta
ttacagaagttacgaagtgaggtccaaatacactcagatcttgacaacgatagaattgta
aagatgagagaagtgtttgaagatgtcgagaagaagtacatctacatcttgttggatctt
tgcaacatggaaacgttaaaggaagtttcttcaaggcgaagaagactacatgagcccgag
atagcgtattggatgaaagaggtgattgaaggcgtcatctacttacaccaacaaaaggtc
atccacagagacttgaagcttgccaatatattcattcacgacatgcacgtcaagatcggc
gattttggacttgcggcacagttggattcgaacagcacaacgagaaaaacgatgtgtggt
actccaacgtcaatggcgcctgaaattattactaaaactggacattcatatgcggtcgac
atttgggcgattggagtcatgttgtattacctcaagtttgggatgaccccctttggatcg
acttctcgcgatcacgtttatgacaagatcaaaaaatgtgagtacggattcccgccgact
aaaagaatatcagacgcacttgtgaaattgattgataactcgttaatgaaagacccaaca
aaacgaccgaccgcagaccaactgttgcagtttgccttttttgatccacacgttgtgcct
gcgtcgttaccagaagactctctgatgcacgacattgatattagaaatcttgtgtattgt
ggagaaaatgaggataagaaggtgcaactacccgaaattgaatccatcaagaggtcgatg
aaggctatgatcacgaaacgaccagccgtcaatgctgtggtgactgaagggaaggagtat
aatgtgatcatcgattatttagacaaaacggataagtacggtgtgatctatttgatggag
gactccactgttggtgggaggttcaacgacaacacgaccatctttttttatggggactat
tattcatattacgggaaagacttatcgaagctcgacgttgctgcgaacgaaatcgataaa
cagactcacgatgtgaacaagaagtgccgcattatcaaaggatttttgaaaaatttggag
ggaggggataagacgaaaaaggatttgaaaatgtgtttggtgaggaaatacaacaaggag
gaaaggttttcgacgtttatatttgaggacaactcgatggagatattctttgggaaggag
gttgcgtactttgtgaacccatatcaggagaatttgattgtgatcaagaatcggcaaaag
tacccgtttgagctggataaaagcaaaattcgacaagtcgacccgaggtgtgatgagcat
tttggattgctgaatttggtgttggacgaactggcgaataagattgtggtaattaattga

DBGET integrated database retrieval system