KEGG   Entamoeba invadens: EIN_494540Help
Entry
EIN_494540        CDS       T04133                                 

Definition
(RefSeq) hypothetical protein
Organism
eiv  Entamoeba invadens
SSDB OrthologParalogGFIT
Motif
Pfam: DDE_Tnp_1_7
Motif
Other DBs
NCBI-GeneID: 14882957
NCBI-ProteinID: XP_004183324
UniProt: A0A0A1TZJ2
Position
Unknown
AA seq 500 aa AA seqDB search
MQEDEIVGTFKWKKEGEAPKSSRHVKASPAPTYSFDPKGSNLTEVECFRLFFCEEIANNL
LLFSNKKIAKEHKTDDNKLSKTSILRYLGILLYMGAHHDIINPVEELWSIDHGKSIYRNS
MPRDMFKFISSHIETYDVGQPDDVCDDAPDTSDDGDVEEKEEADIGPEGEYFNCAEYSDR
DFRDLSEEQLRKDVRINGGIVGSGVVKVVPAITPNAHDSFSKIRVILDKFISNLVNQTYY
KPSNSVSVDEHLCSYKGHMWAKVFIKSKPGRYGIKFWMCADCETGMTLNLQMYCGKCGGK
EYNQGFRVVRDMVLPMLCRGNKFTVVCDNFFCTLRLSHYLASCGCQLLGTMRINRKELPD
EAKAIKGRTPDTTIFFSKGKCKLISYFNEKKKLVLVLSTCHEKNEIEVVEQDVFIGKEKM
TIHKPQPILDYNHKMGGVDTVDQMTRYYTCRRRTNRWNIRALYDMIDIAALNAYKTYSNY
HPCKRVDFFNNLSGALMKMK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagacgagattgttggcacatttaaatggaagaaagaaggagaagcaccaaaa
agctcacgacacgttaaagcttcgcctgctccgacttactcgtttgatcccaaaggaagt
aatttaactgaagttgagtgttttaggttgtttttttgtgaagagatagcaaataacctt
ttgttgttttcaaataaaaaaatagccaaagaacataagactgatgataacaaactttct
aaaactagcatcctgaggtacctaggaattcttctctacatgggagctcaccatgatatc
attaatccagtggaagagctttggtcaatcgaccacggaaaatctatttatagaaatagc
atgccacgtgacatgtttaaattcatttcttcacacatcgaaacttacgatgtgggccag
ccagatgatgtttgtgatgatgcaccagacacttcagatgatggggatgtcgaagaaaaa
gaggaagctgacatcggaccagaaggagagtatttcaactgcgcggaatattcagatcga
gatttcagagatctctctgaagagcaactcaggaaagatgtcagaatcaatgggggaatc
gttggtagtggagttgttaaagtcgtccctgcaataactccaaatgcacacgacagcttt
tctaaaattagagtgattttagataagtttatttctaaccttgtcaaccaaacctattac
aaacctagtaatagtgtttcggttgacgaacatttgtgttcttataaagggcatatgtgg
gctaaggtgtttattaagtctaagcctggacgttatggtataaagttttggatgtgtgct
gactgtgaaacaggaatgactctaaacctccaaatgtactgtggtaagtgtggtggtaag
gaatacaatcagggctttagagtggtcagggacatggtgctacccatgttatgccgtggt
aacaagtttacagttgtgtgtgacaacttcttctgtacgttaaggttgtcacactacctt
gcttcatgtgggtgccaacttttgggaaccatgaggattaataggaaagaacttcctgac
gaagccaaggcaatcaaaggaagaactcccgataccaccatctttttctcgaaaggaaag
tgtaagctcatctcttacttcaacgagaaaaagaagctggtattggtcttgtcaacctgc
cacgaaaagaatgaaattgaagtcgtcgagcaggatgtgttcattggcaaagaaaaaatg
acaatacacaaaccccagcccatccttgattacaaccacaaaatgggtggggttgacact
gtggatcagatgaccaggtattatacgtgtagacgtcgaacaaacaggtggaacatcagg
gctttatatgatatgattgatatagctgccttaaacgcgtataaaacgtactcaaattac
cacccttgcaaacgagtagatttttttaacaatctttctggtgctttaatgaaaatgaaa
tga

DBGET integrated database retrieval system