KEGG   Enterobacter kobei: BFV64_00620Help
Entry
BFV64_00620       CDS       T04686                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ekb  Enterobacter kobei
Pathway
ekb00051  Fructose and mannose metabolism
ekb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BFV64_00620
Enzymes [BR:ekb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BFV64_00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AOP84950
Position
complement(123852..125000)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDDVIDLIASVDLITTAVGPVVLERIAPAVAKGLAKRKAQGIDTPLNIIAC
ENMVRGTTQLKGHVMAAVADEDKAWVDAHVGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHYRSDQDPQAIELAQLIDDKGAQAALAQ
ISGLDANSDVVVEAVNAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaacatcggtcgtggttttatcggcaaactgctg
gcagacgcgggcattacgctgacgttcgccgatgtgaatcaggtggtcctggatgccctg
aatgcccgtcatagctatcaggtccatgtggtgggcgaaaacgagcaggtcgataccgtc
tcaggcgtgaacgcggtcagcagcattggcgacgacgtaatcgacctgattgccagcgtt
gaccttatcaccacggcggtaggcccggtggttctggagcgtatcgccccggcggtggct
aaaggcctggcaaaacgtaaagcgcagggcatcgacaccccgctgaacatcatcgcctgt
gaaaacatggtacgcggcaccacacagctgaaaggccatgtcatggcggccgtggctgac
gaagataaagcctgggtcgacgcgcacgttgggtttgtggattccgccgtggaccgcatc
gttccgccgtcagcatccgccacccacgacccgctggaagtgaccgtggaaaccttcagc
gagtggatcgtcgataaaactcagtttaaaggtgcgctgccaactattccgggaatggaa
ttaaccgataacctgatggcatttgtcgaacgcaaactcttcacgctgaacaccgggcat
gctataaccgcgtacctcggaaaattggccggtcatcagaccattcgcgatgcgatcctc
gatgagaaaatccgcgcggtggtaaaaggggccatggaagagagcggcgcggtgctgatc
aaacgctacggttttgatgctgataaacacgcagcctacatccagaaaatcctcggtcgc
tttgaaaacccgtatctgaaagatgatgttgagcgcgtgggacgtcaaccgctgcgtaag
ctgagtgcaggcgaccgtctgattaagccgctgctcggcacgctggaatacggtctgccg
catgccaacctggtgaaagggattgccgctgcaatgcactaccgcagcgatcaggacccg
caggcgatcgagctggctcagctgattgatgacaaaggcgcgcaggctgcgctggcgcag
atttccggtctggacgccaatagcgacgtggttgtggaggcggttaacgcatacaacgca
accaaatga

DBGET integrated database retrieval system